(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE288

ASPNC_1.PE288        Location/Qualifiers
FT   CDS             join(complement(719787..721921),complement(719656..719716))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217922" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876810"
FT                   /gene_name="pab1"
FT                   /orf_name="An01g03050"
FT                   /product="Polyadenylate-binding protein, cytoplasmic and
FT                   nuclear"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /biological_process="mRNA transport"
FT                   /biological_process="regulation of translation "
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK43671.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="GO:0006417"
FT                   /db_xref="GO:0051028"
FT                   /db_xref="HOGENOM:HBG756718"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002004"
FT                   /db_xref="InterPro:IPR006515"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI0000EF9F58"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q848"
FT                   /transl_table=1
FT                   /translation="MSADVSTTPAAENVNGAAEASPAPAAAAPSATTPEVTAVENSTPA
FT                   PAANQPHSASLYVGELDPSVTEAMLYELFSSIGQVASIRVCRDAVTRRSLGYAYVNYNN
FT                   TADGERALEDLNYTLIKGKPCRIMWSQRDPALRKTGQGNVFIKNLDSAIDNKALHDTFA
FT                   AFGNILSCKVAQDEFGNSKGYGFVHYETAEAANNAIKHVNGMLLNDKKVFVGHHISKKD
FT                   RQSKFEEMKANFTNVYIKNLDSEIDDDEFRKMFEKFGEITSATLSRDQEGKSRGFGFVN
FT                   FSTHESAQAAVEEMNDKEIRSQKLYVGRAQKKHEREEELRKQYEAARLEKASKYQGVNL
FT                   YVKNLTDDIDDEKLRELFGPYGTITSAKVMRDTNVERDQSPDSAGKEKEADKENDKEAT
FT                   PEAEKAEKAEEKPSESSEEKDKEAKKSDKKPFGKSKGFGFVCFSSPDEASKAVTEMNQR
FT                   MVNGKPLYVALAQRKDVRRSQLEASIQARNTIRQQQAAAAAGMPQPYMQPAVFYGPGQQ
FT                   GFIPGGQRGMAFPPQPGMVMGIPGGRPGQYPGPFPGQQGGRGMGPNQQIPPNFAQGIPM
FT                   GMQGPGGIPNGMGYPQMAQVQFGRGAGGRGQVPGMPMGQGMRGGPGYGQGRGAPVQQGQ
FT                   MRPGQGGRGQNAAAPAGPQEGAAGGVNAQTLGAAPPAQQKQMLGEALYPKIQAQQPELA
FT                   GKITGMLLEMDNTELLSLTRKPCAPRSMRPLAFTMST"
     MSADVSTTPA AENVNGAAEA SPAPAAAAPS ATTPEVTAVE NSTPAPAANQ PHSASLYVGE        60
     LDPSVTEAML YELFSSIGQV ASIRVCRDAV TRRSLGYAYV NYNNTADGER ALEDLNYTLI       120
     KGKPCRIMWS QRDPALRKTG QGNVFIKNLD SAIDNKALHD TFAAFGNILS CKVAQDEFGN       180
     SKGYGFVHYE TAEAANNAIK HVNGMLLNDK KVFVGHHISK KDRQSKFEEM KANFTNVYIK       240
     NLDSEIDDDE FRKMFEKFGE ITSATLSRDQ EGKSRGFGFV NFSTHESAQA AVEEMNDKEI       300
     RSQKLYVGRA QKKHEREEEL RKQYEAARLE KASKYQGVNL YVKNLTDDID DEKLRELFGP       360
     YGTITSAKVM RDTNVERDQS PDSAGKEKEA DKENDKEATP EAEKAEKAEE KPSESSEEKD       420
     KEAKKSDKKP FGKSKGFGFV CFSSPDEASK AVTEMNQRMV NGKPLYVALA QRKDVRRSQL       480
     EASIQARNTI RQQQAAAAAG MPQPYMQPAV FYGPGQQGFI PGGQRGMAFP PQPGMVMGIP       540
     GGRPGQYPGP FPGQQGGRGM GPNQQIPPNF AQGIPMGMQG PGGIPNGMGY PQMAQVQFGR       600
     GAGGRGQVPG MPMGQGMRGG PGYGQGRGAP VQQGQMRPGQ GGRGQNAAAP AGPQEGAAGG       660
     VNAQTLGAAP PAQQKQMLGE ALYPKIQAQQ PELAGKITGM LLEMDNTELL SLTRKPCAPR       720
     SMRPLAFTMS T                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page