(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE289

ASPNC_1.PE289        Location/Qualifiers
FT   CDS             join(complement(724276..727293),complement(723548..724219))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211433" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876811"
FT                   /orf_name="An01g03060"
FT                   /product="Function: pub1"
FT                   /EC_number="6.3.2.19"
FT                   /function="ubiquitin-protein ligase activity"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAK43672.1"
FT                   /db_xref="GO:0004842"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="HOGENOM:HBG329855"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR000569"
FT                   /db_xref="UniParc:UPI0000EF9F59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q849"
FT                   /transl_table=1
FT                   /translation="MFQSFTGNSRRPRQVNLGGRNTNPFAAYPSGRQNPHGAGPQNTLA
FT                   IAQQERLARQQERERLTASRLVQRTWRGYRSRKITRRTWRNEWDTTEKKQGKDHVPSFE
FT                   ILAQQPDVVLQPSLRYGTAADCLSQLRLLVQFLEPWDSGDIARLVYFSEAFQRTLHEVP
FT                   SIATEGEWTTPLKKLASLTLRVLRSVTSPTVPVFAVQRLLQLLVFLTGLIPKHMARLAK
FT                   EYYSVMVILTTDFESISTRYKLSRDSLTESVLALLRPITSETLTAYEWFAKIYLTIPNL
FT                   PEYIGSLDGLANNINYKLLTSALGPLQTLFGDRPKSAEDVDARLWLLAYFIFFHRCALG
FT                   GQTGRPAPEPGFVKVVSELLNSTAVHISRRLESEESNDYDEAPEQTPLHPFIKEQLVSL
FT                   VNQSNITGLLSQLHTTHLSQGELANAQSDASKEAKILATYALTLLRVFPRRGDDIRMWL
FT                   YLGSATSSDQLTGQEGSRIPAIKYFWQASKASRIFAAISQDSTKVLPLLKPAEESQGTR
FT                   SPEISQVERDEEWTIILLFLELYTFVLKVMDDEEFFSSESSFTASSNTRVSWTKESALP
FT                   LKDIKDMTIFLKNLGFTLYWNSADLSEKEATQDTGGIRSYFSSSAAPPDAIASVRDIEM
FT                   KNKEKGLPGVTGIPLDYFKGLVTGLLRMIHERDSRRKFLPDGHWLMTSRFDMEGFIPAV
FT                   VAEEENRHQLQDEDEEEEQDDLMSDAYFEPSPGLIGTGRAQLTRRIEALRRRQQQAARR
FT                   KQLEAVAPRMEILRNMPFFIPFPTRVQIFREFIYRDQMRRRQGYIDPDAWRMSVAQASM
FT                   GRLIDGRPAVQDILSRHHANIRRESIFKDAFDEFYELGDGLKEPIQITFIDKFNTTEAG
FT                   IDGGGVTKEFLTSVTSEAFKSTSDLNLFEENDQHLLYPNPAAVEQRRELLRQLGFVENT
FT                   AEWNENVRDLLRRYEFLGRIIGKCLYEGILVDVNFAPFFLLKWALTGGTGSAQRETAYR
FT                   ANLNDLKDLDQGLYQGLLQLKNYPGDVEDFSLNFTVTDTIPLPDGGNRTTTRDLKSHGS
FT                   DIPVTNQNRLVYISYIARYRLQVQPALQTNAFLQGLGQIIQPSWLSMFNQTELQTLVSG
FT                   DSGDIDVADLRRNTLYGGVYTIGDDKEEHPTVKLFWEVMEKMSNEERQKVLRFVTSTPR
FT                   APLLGFSHLNPRFSIRDSSEDQERLPSTSTCVNLLKLPRYTNANILREKLLYAVNSGAG
FT                   FDLS"
     MFQSFTGNSR RPRQVNLGGR NTNPFAAYPS GRQNPHGAGP QNTLAIAQQE RLARQQERER        60
     LTASRLVQRT WRGYRSRKIT RRTWRNEWDT TEKKQGKDHV PSFEILAQQP DVVLQPSLRY       120
     GTAADCLSQL RLLVQFLEPW DSGDIARLVY FSEAFQRTLH EVPSIATEGE WTTPLKKLAS       180
     LTLRVLRSVT SPTVPVFAVQ RLLQLLVFLT GLIPKHMARL AKEYYSVMVI LTTDFESIST       240
     RYKLSRDSLT ESVLALLRPI TSETLTAYEW FAKIYLTIPN LPEYIGSLDG LANNINYKLL       300
     TSALGPLQTL FGDRPKSAED VDARLWLLAY FIFFHRCALG GQTGRPAPEP GFVKVVSELL       360
     NSTAVHISRR LESEESNDYD EAPEQTPLHP FIKEQLVSLV NQSNITGLLS QLHTTHLSQG       420
     ELANAQSDAS KEAKILATYA LTLLRVFPRR GDDIRMWLYL GSATSSDQLT GQEGSRIPAI       480
     KYFWQASKAS RIFAAISQDS TKVLPLLKPA EESQGTRSPE ISQVERDEEW TIILLFLELY       540
     TFVLKVMDDE EFFSSESSFT ASSNTRVSWT KESALPLKDI KDMTIFLKNL GFTLYWNSAD       600
     LSEKEATQDT GGIRSYFSSS AAPPDAIASV RDIEMKNKEK GLPGVTGIPL DYFKGLVTGL       660
     LRMIHERDSR RKFLPDGHWL MTSRFDMEGF IPAVVAEEEN RHQLQDEDEE EEQDDLMSDA       720
     YFEPSPGLIG TGRAQLTRRI EALRRRQQQA ARRKQLEAVA PRMEILRNMP FFIPFPTRVQ       780
     IFREFIYRDQ MRRRQGYIDP DAWRMSVAQA SMGRLIDGRP AVQDILSRHH ANIRRESIFK       840
     DAFDEFYELG DGLKEPIQIT FIDKFNTTEA GIDGGGVTKE FLTSVTSEAF KSTSDLNLFE       900
     ENDQHLLYPN PAAVEQRREL LRQLGFVENT AEWNENVRDL LRRYEFLGRI IGKCLYEGIL       960
     VDVNFAPFFL LKWALTGGTG SAQRETAYRA NLNDLKDLDQ GLYQGLLQLK NYPGDVEDFS      1020
     LNFTVTDTIP LPDGGNRTTT RDLKSHGSDI PVTNQNRLVY ISYIARYRLQ VQPALQTNAF      1080
     LQGLGQIIQP SWLSMFNQTE LQTLVSGDSG DIDVADLRRN TLYGGVYTIG DDKEEHPTVK      1140
     LFWEVMEKMS NEERQKVLRF VTSTPRAPLL GFSHLNPRFS IRDSSEDQER LPSTSTCVNL      1200
     LKLPRYTNAN ILREKLLYAV NSGAGFDLS                                        1229
//

If you have problems or comments...

PBIL Back to PBIL home page