(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE290

ASPNC_1.PE290        Location/Qualifiers
FT   CDS             join(complement(729081..729263),complement(728781..729002))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211444" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806686"
FT                   /orf_name="An01g03070"
FT                   /product="Similarity to mitochondrial ribosomal protein
FT                   Yml27 - Saccharomyces cerevisiae"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43673.1"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="HOGENOM:HBG329857"
FT                   /db_xref="InterPro:IPR019189"
FT                   /db_xref="UniParc:UPI0000EF9F5A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q850"
FT                   /transl_table=1
FT                   /translation="MFKPSQPMLARLRLTTKQVLGGYYKGNRTGSMGYFAKNGSYVIDW
FT                   KKVRTFVVPENLDQFKLTPFVTKRMPPTKSKYTKEVEKRGRIVTLERAFSGKDYLDMWA
FT                   SDNGQEVLEQERLDSEAATEQSSTTQPARQ"
     MFKPSQPMLA RLRLTTKQVL GGYYKGNRTG SMGYFAKNGS YVIDWKKVRT FVVPENLDQF        60
     KLTPFVTKRM PPTKSKYTKE VEKRGRIVTL ERAFSGKDYL DMWASDNGQE VLEQERLDSE       120
     AATEQSSTTQ PARQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page