(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE291

ASPNC_1.PE291        Location/Qualifiers
FT   CDS             join(729584..732322,732411..732593)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211457" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806687"
FT                   /orf_name="An01g03080"
FT                   /product="Similarity to hypothetical coiled-coil protein -
FT                   Schizosaccharomyces pombe"
FT                   /biological_process="rRNA processing"
FT                   /cellular_component="small-subunit processome"
FT                   /protein_id="CAK43674.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0032040"
FT                   /db_xref="HOGENOM:HBG329858"
FT                   /db_xref="InterPro:IPR006709"
FT                   /db_xref="UniParc:UPI0000EF9F5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q851"
FT                   /transl_table=1
FT                   /translation="MPRRQTQMRGPKDRDQSLQKSKKPAPKNKKSGNYLNAFAIAESEN
FT                   PGKLGVKRTRLGKEDEPFKRKRHNARDADDSDGPDYSKRRRTGDDEASEMDSNAGSDGE
FT                   GHRWRIGEVGSDDDSELDSDEAMGSSDEERFEGFTFRGSSTMKNKPKQKAPERKKRTRE
FT                   INLSEDAEVSEDEDDLEDDSDDLGEDAIDLTTAWDMNMAEEEEEKAKKAKSKSKQSAES
FT                   DESEEYDSESEDSDSDDNDDELPLSGDDMDEDEVDEHGLSKLQSFVNAMNTEGTTKTAR
FT                   KTGGKQEQGAPTEFGLTSTRKLTIADLLPSITDSRLKSSLKHVDATTTSNTKTSGVPGK
FT                   LDAPLAKRQQDRLDRAAAYEKSKETLDRWLETVKANRRAEHLVFPLPDPEANQTHRMGA
FT                   AEPRTDLESTIQNILQESGLIENNGKSAEEQVQEFEELQARKLPIEEIRARRAELRKRR
FT                   DLLFREEVRAKRIKKIKSKSYRRVHRKERERLEQQERQALLEAGVDLDEEEREKNDRLR
FT                   AEARMGSKHKESKWAKSLKQTGRTAWDEDARRGTQDLALREEELRKRIEGKRVTNGDED
FT                   YLGSSSSESEDEDPWDEEAGSDAEKRKIRQKLSQLEGDDDADTELKGPHAKLLSMKFMQ
FT                   NADAARKAENDAEVRRLNRELHGEESQSEAESEVGRRKFGRKKEEAKTAKESKAKLARN
FT                   EFEEAPGSDDEAQQEADQEVDIVVDRPAKKGPAAPQNKPRGRPQKEIAEEEDAAAVEEN
FT                   PWLVQTNRNNRRAIVNDSQQTVDITLDDANASSGKSKSAPKAQKASAPSKKKVDAEVYG
FT                   SDDEESVPVLLKNHDLVKRAFAGDEVVQDFEQEKFDTIKEEDDQVIDNTLPGWGSWAGD
FT                   GISKKQQKRQKRFLTKVEGVKPEDRKDAKLSRVIINEKRVKKNTKYMATQLPHPFETKQ
FT                   QYERSLRLPIGPEWSTKETFQNATKPRVMIKQGVIKPMEKPMA"
     MPRRQTQMRG PKDRDQSLQK SKKPAPKNKK SGNYLNAFAI AESENPGKLG VKRTRLGKED        60
     EPFKRKRHNA RDADDSDGPD YSKRRRTGDD EASEMDSNAG SDGEGHRWRI GEVGSDDDSE       120
     LDSDEAMGSS DEERFEGFTF RGSSTMKNKP KQKAPERKKR TREINLSEDA EVSEDEDDLE       180
     DDSDDLGEDA IDLTTAWDMN MAEEEEEKAK KAKSKSKQSA ESDESEEYDS ESEDSDSDDN       240
     DDELPLSGDD MDEDEVDEHG LSKLQSFVNA MNTEGTTKTA RKTGGKQEQG APTEFGLTST       300
     RKLTIADLLP SITDSRLKSS LKHVDATTTS NTKTSGVPGK LDAPLAKRQQ DRLDRAAAYE       360
     KSKETLDRWL ETVKANRRAE HLVFPLPDPE ANQTHRMGAA EPRTDLESTI QNILQESGLI       420
     ENNGKSAEEQ VQEFEELQAR KLPIEEIRAR RAELRKRRDL LFREEVRAKR IKKIKSKSYR       480
     RVHRKERERL EQQERQALLE AGVDLDEEER EKNDRLRAEA RMGSKHKESK WAKSLKQTGR       540
     TAWDEDARRG TQDLALREEE LRKRIEGKRV TNGDEDYLGS SSSESEDEDP WDEEAGSDAE       600
     KRKIRQKLSQ LEGDDDADTE LKGPHAKLLS MKFMQNADAA RKAENDAEVR RLNRELHGEE       660
     SQSEAESEVG RRKFGRKKEE AKTAKESKAK LARNEFEEAP GSDDEAQQEA DQEVDIVVDR       720
     PAKKGPAAPQ NKPRGRPQKE IAEEEDAAAV EENPWLVQTN RNNRRAIVND SQQTVDITLD       780
     DANASSGKSK SAPKAQKASA PSKKKVDAEV YGSDDEESVP VLLKNHDLVK RAFAGDEVVQ       840
     DFEQEKFDTI KEEDDQVIDN TLPGWGSWAG DGISKKQQKR QKRFLTKVEG VKPEDRKDAK       900
     LSRVIINEKR VKKNTKYMAT QLPHPFETKQ QYERSLRLPI GPEWSTKETF QNATKPRVMI       960
     KQGVIKPMEK PMA                                                          973
//

If you have problems or comments...

PBIL Back to PBIL home page