(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE294

ASPNC_1.PE294        Location/Qualifiers
FT   CDS             join(743281..743628,743747..744079,744152..744570,
FT                   744643..744670,744868..745008)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959935"
FT                   /orf_name="An01g03110"
FT                   /product="Similarity to ribosomal protein of the small
FT                   subunit Rsm7 - Saccharomyces cerevisiae "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAK43677.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG323880"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="UniParc:UPI0000EF9D57"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q854"
FT                   /transl_table=1
FT                   /translation="MPPRLNLFTARAVPVLRQSANSSAASRRSFATILNTNRPCAASTG
FT                   HGLKSGLSASVRGQRRCNSSGSDGQDRPKGPTEDPLPHVSEEAAEVSKIMDKKCDGTPA
FT                   SPELEQGSPISEILQRDKEALKHMPKVMQDQMKRPSGSRSFSTSARRLQPELQGKELDD
FT                   ASASVVANMISQVNQQATELHPGLKFEAPQNLPKTENFRKRYETIVEQFTKLLMQDGKL
FT                   SKAQNTMAFILDHLRTAPPPNINPRRRLLPGPPAPQLPLNPVLYLTLIVDSVAPLLKLR
FT                   QQKGIVGGGVSVQVPSPLALRQRRRTAIKWIIDASDKRRDAIFGQRVANELVAVAEGRS
FT                   GVWDKREQVHKLGVAGRSNLGLVARRRAFGYIVPMMCEVDATNEVLDSGHEPMTRAMTN
FT                   SASRGWVPLQSRPILAPRKAAYL"
     MPPRLNLFTA RAVPVLRQSA NSSAASRRSF ATILNTNRPC AASTGHGLKS GLSASVRGQR        60
     RCNSSGSDGQ DRPKGPTEDP LPHVSEEAAE VSKIMDKKCD GTPASPELEQ GSPISEILQR       120
     DKEALKHMPK VMQDQMKRPS GSRSFSTSAR RLQPELQGKE LDDASASVVA NMISQVNQQA       180
     TELHPGLKFE APQNLPKTEN FRKRYETIVE QFTKLLMQDG KLSKAQNTMA FILDHLRTAP       240
     PPNINPRRRL LPGPPAPQLP LNPVLYLTLI VDSVAPLLKL RQQKGIVGGG VSVQVPSPLA       300
     LRQRRRTAIK WIIDASDKRR DAIFGQRVAN ELVAVAEGRS GVWDKREQVH KLGVAGRSNL       360
     GLVARRRAFG YIVPMMCEVD ATNEVLDSGH EPMTRAMTNS ASRGWVPLQS RPILAPRKAA       420
     YL                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page