(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE296

ASPNC_1.PE296        Location/Qualifiers
FT   CDS             join(complement(749665..750443),complement(749507..749513))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959936"
FT                   /orf_name="An01g03130"
FT                   /product="Remark: Protein is rich in proline "
FT                   /protein_id="CAK43679.1"
FT                   /db_xref="UniParc:UPI0000EF9D59"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q856"
FT                   /transl_table=1
FT                   /translation="MSDQSKQPESSTNNPSQEGENNNNNTTSSPSSPQQENPPTGDQEG
FT                   QEQKPEDTNDTTEDKPKEEEKEEDKQEDEDPQPKQEEQEQEPEPEKEPQPKQEPQEQED
FT                   KAPKQEPQSSDEEPEPEPEQRAPQPSQDRKRRSRPPQKLRQRDDYSDMDNNQQVDRPRR
FT                   QRRQRPQQQQQGQDGGPLGGLPGVGQAGDLVQNTAGNALNGVTGSAGKAVGGILGGGGG
FT                   GEEKEGKDEQLRLRLDLNLDIEVQLKAKIHGDLTLGLLN"
     MSDQSKQPES STNNPSQEGE NNNNNTTSSP SSPQQENPPT GDQEGQEQKP EDTNDTTEDK        60
     PKEEEKEEDK QEDEDPQPKQ EEQEQEPEPE KEPQPKQEPQ EQEDKAPKQE PQSSDEEPEP       120
     EPEQRAPQPS QDRKRRSRPP QKLRQRDDYS DMDNNQQVDR PRRQRRQRPQ QQQQGQDGGP       180
     LGGLPGVGQA GDLVQNTAGN ALNGVTGSAG KAVGGILGGG GGGEEKEGKD EQLRLRLDLN       240
     LDIEVQLKAK IHGDLTLGLL N                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page