(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE298

ASPNC_1.PE298        Location/Qualifiers
FT   CDS             join(755202..755293,755348..756155)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211523" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18959937"
FT                   /orf_name="An01g03150"
FT                   /product="Similarity to hypothetical protein EAA66565.1 -
FT                   Aspergillus nidula"
FT                   /protein_id="CAK43681.1"
FT                   /db_xref="HOGENOM:HBG329862"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="UniParc:UPI0000EF9D5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q858"
FT                   /transl_table=1
FT                   /translation="MQNDNNIVETEGAGNFTCGLNIGGAPVPREGSPQTATTQSPNPAQ
FT                   PAASICESTYIKREIPLDKRTRKERQEKKQNEAKMAPDRSNISFTITHMNANHQDSLAA
FT                   YLQVYCHVSAREAKSARLEDITLSDLVISANGTRYTVPIDPAMGSFSESRSRLVAMHQE
FT                   CLARLGRSDITIKEYRRPEGIEIFLFFVFATALVAFSRRSNFLPGSLFYETVGLGAVPP
FT                   LAQLFYKTQPFVLTVMAGSHVVEASLFTVKRLKRHGVPVLSLVWCAWVVSNLIEGYTVW
FT                   RRFDWVVRQEGAKREHGK"
     MQNDNNIVET EGAGNFTCGL NIGGAPVPRE GSPQTATTQS PNPAQPAASI CESTYIKREI        60
     PLDKRTRKER QEKKQNEAKM APDRSNISFT ITHMNANHQD SLAAYLQVYC HVSAREAKSA       120
     RLEDITLSDL VISANGTRYT VPIDPAMGSF SESRSRLVAM HQECLARLGR SDITIKEYRR       180
     PEGIEIFLFF VFATALVAFS RRSNFLPGSL FYETVGLGAV PPLAQLFYKT QPFVLTVMAG       240
     SHVVEASLFT VKRLKRHGVP VLSLVWCAWV VSNLIEGYTV WRRFDWVVRQ EGAKREHGK        299
//

If you have problems or comments...

PBIL Back to PBIL home page