(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE300

ASPNC_1.PE300        Location/Qualifiers
FT   CDS             758131..759162
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217090" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15876813"
FT                   /orf_name="An01g03170"
FT                   /product="Similarity to hypothetical protein CG16717 -
FT                   Drosophila melanogaster"
FT                   /function="hydrolase activity"
FT                   /protein_id="CAK43683.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG329865"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI0000EF9D5D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q860"
FT                   /transl_table=1
FT                   /translation="MAPPTTSPPKTIKTSLLLLSDTHTLTPLPPIHPNTSTPFRHPLPA
FT                   TDLLIHAGDLTKVGHKHEHLTTLSFLKSARAPIKLIIPGNHDITLDEPYYKKIGHYRHR
FT                   YRTDHTAPSATSGSDNVSAGKGTPGMALSDDELREIKELYTGKEAWDAGIRYLEEGTHV
FT                   FRLQNGAVLRVYASPWTPEFCQWGFGYPRQVDRYNPPEEEGEGEEGAENPVPDYPGVDV
FT                   MITHGPPYGVLDQVVPNHMSVGCEHLYRAVKRARPRVHVFGHIHEGYGATRREWSSGNE
FT                   SVIQCDKERTLEERCARVDVSKEGGNGLRVGEETLFVNASVVTVQYQAINAPWVVEVDL
FT                   PVE"
     MAPPTTSPPK TIKTSLLLLS DTHTLTPLPP IHPNTSTPFR HPLPATDLLI HAGDLTKVGH        60
     KHEHLTTLSF LKSARAPIKL IIPGNHDITL DEPYYKKIGH YRHRYRTDHT APSATSGSDN       120
     VSAGKGTPGM ALSDDELREI KELYTGKEAW DAGIRYLEEG THVFRLQNGA VLRVYASPWT       180
     PEFCQWGFGY PRQVDRYNPP EEEGEGEEGA ENPVPDYPGV DVMITHGPPY GVLDQVVPNH       240
     MSVGCEHLYR AVKRARPRVH VFGHIHEGYG ATRREWSSGN ESVIQCDKER TLEERCARVD       300
     VSKEGGNGLR VGEETLFVNA SVVTVQYQAI NAPWVVEVDL PVE                         343
//

If you have problems or comments...

PBIL Back to PBIL home page