(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE303

ASPNC_1.PE303        Location/Qualifiers
FT   CDS             join(complement(775691..775940),complement(775467..775634),
FT                   complement(775050..775399),complement(774267..774983),
FT                   complement(774139..774193),complement(773971..774008))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000197738" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806931"
FT                   /orf_name="An01g03200"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAK43686.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG324210"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0000EF9D76"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q863"
FT                   /transl_table=1
FT                   /translation="MSLLSLPPRVQKAAAEMSDNESPGTARAELPRQFSFLSTLALGYS
FT                   ITNSWAGYAGILSIPLVMGGGPTAFFGLFLASIACCFITAGLAELASAFPTSGGPYHFA
FT                   FIVSAPKHRAAVSFVVGWLTMISWCTVSTSNGIVCAQMINGLVTVHRPSVTVTAWRIYL
FT                   IYLPIVLLSTVVVCYLPRVIPLIEDCIIIFSLLTFGTSLITVLAMQDQKQSAHTLFLAY
FT                   ENHTGWSDGTAFMIGAGTCMYAYITVDSVTHIADEVPNPGRNIPRAMMATVLTGMVTCI
FT                   PYAIAILFCTTDLKAVASSPIPIYTAYLQATSSPVVATLFTAWVIFFYCAAELSCLLTA
FT                   GRLAYTFARAGGLPYSSFFVKITNEMPLNATLGCCVFICLYGLIYIGSATAFDSFISIV
FT                   IIALNICYVVPQAIVLLRGRDAVLGRRAFAMGKYFGLFCNTVAVVWVAVILVFFCLPLK
FT                   IPTTVHDMNYASVVLAGFVALIGIGWWGGKRKTFTGPLQDIESPHSGQTGTARVHALSL
FT                   ALTSNCTT"
     MSLLSLPPRV QKAAAEMSDN ESPGTARAEL PRQFSFLSTL ALGYSITNSW AGYAGILSIP        60
     LVMGGGPTAF FGLFLASIAC CFITAGLAEL ASAFPTSGGP YHFAFIVSAP KHRAAVSFVV       120
     GWLTMISWCT VSTSNGIVCA QMINGLVTVH RPSVTVTAWR IYLIYLPIVL LSTVVVCYLP       180
     RVIPLIEDCI IIFSLLTFGT SLITVLAMQD QKQSAHTLFL AYENHTGWSD GTAFMIGAGT       240
     CMYAYITVDS VTHIADEVPN PGRNIPRAMM ATVLTGMVTC IPYAIAILFC TTDLKAVASS       300
     PIPIYTAYLQ ATSSPVVATL FTAWVIFFYC AAELSCLLTA GRLAYTFARA GGLPYSSFFV       360
     KITNEMPLNA TLGCCVFICL YGLIYIGSAT AFDSFISIVI IALNICYVVP QAIVLLRGRD       420
     AVLGRRAFAM GKYFGLFCNT VAVVWVAVIL VFFCLPLKIP TTVHDMNYAS VVLAGFVALI       480
     GIGWWGGKRK TFTGPLQDIE SPHSGQTGTA RVHALSLALT SNCTT                       525
//

If you have problems or comments...

PBIL Back to PBIL home page