(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE306

ASPNC_1.PE306        Location/Qualifiers
FT   CDS             join(779953..780012,780082..781200)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211567" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111053"
FT                   /orf_name="An01g03230"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43689.1"
FT                   /db_xref="InterPro:IPR007718"
FT                   /db_xref="UniParc:UPI0000EF9D79"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q866"
FT                   /transl_table=1
FT                   /translation="MAGQKSKQAKPAKASKSKETPAPPAQLVAALSAFLSESGFSKTKE
FT                   AFTKELASKSIDSDAKNVPSLLELYQSWEKSSEKSSGSSSSDSDSDSESESGSESDSES
FT                   SDSSSDESSDSDVEMNDKSESDSDSDSDDEEEKKKPAAPAAKSQGTKRKAESSSSESDS
FT                   ESEADEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEESSDSDSSSDDSSSSSS
FT                   ESDSDSDSDSDSDSSSDDEDDKKADKKALKAATKTPLPPSESSSSGSSPSSSSDSDTTG
FT                   TVSNSDSAPKEQSKSAQTSYSSSASPAPGNGPQKKKHTGARPTPLAQLSELPTDHLLSN
FT                   DYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD"
     MAGQKSKQAK PAKASKSKET PAPPAQLVAA LSAFLSESGF SKTKEAFTKE LASKSIDSDA        60
     KNVPSLLELY QSWEKSSEKS SGSSSSDSDS DSESESGSES DSESSDSSSD ESSDSDVEMN       120
     DKSESDSDSD SDDEEEKKKP AAPAAKSQGT KRKAESSSSE SDSESEADEA PKSKKTKVTS       180
     AKEESSDSDS SDSESDSSSS SSESEESSDS DSSSDDSSSS SSESDSDSDS DSDSDSSSDD       240
     EDDKKADKKA LKAATKTPLP PSESSSSGSS PSSSSDSDTT GTVSNSDSAP KEQSKSAQTS       300
     YSSSASPAPG NGPQKKKHTG ARPTPLAQLS ELPTDHLLSN DYVPYAYAEK AWQDLSVTRG       360
     KGFTKEKNKK KRGSYRGGPI DISGGKSFKF DD                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page