(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE307

ASPNC_1.PE307        Location/Qualifiers
FT   CDS             complement(781851..783725)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211578" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806932"
FT                   /orf_name="An01g03240"
FT                   /product="Similarity to hypothetical protein B23I11.30 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK43690.1"
FT                   /db_xref="HOGENOM:HBG329869"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI0000EF9D7A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q867"
FT                   /transl_table=1
FT                   /translation="MLAELPPEIIQLITSYLPSASALVNLSRTCWRLHHVVAAQDWRIF
FT                   RSFVETKFPGVETPEIWREAAQALTSRSRALDKHAVVGRFVVPASEAVKVGSHSSTRRD
FT                   NPTHGYRPALDSYEVWNGSSWNDRKEVLAWGAADELVLRIAEPGPNSKGKWVVFNDLDH
FT                   ISSHDDICGVHILRPGHPSKEPQTEHIVVARARGELFHLSIDPNIACHIYKQRFMTSGG
FT                   GIERTDMSDGKDPILSAHLSDGSISFFSTTSGEAEVYPFARLNADSSNNATISSRHKYS
FT                   KFLSPSLFAVGTGRIHDAITISAITPQGLSPSRELNVELVDFERLNLDTTIRSNVNAIA
FT                   PLDPTGQVFLAAWGDRAIRYNHPICHYSTLYANTLRLHDLRSNEEYEKTYRDTTDQNPI
FT                   YCIHPFGHDRFVVGAGGDALVKIFDLRMPKHDTYSYRDARPSRTLLKNNEPIVDSLSSL
FT                   SLTATNNSIAFPRKDISIFLSAHPPSSRPQGRRRHNTRSYRGAIYSMTSPSPSSPTIYT
FT                   GVADGVVRLDFASTDDLLGPCQDWYREPLLLSNDVRLENTVAHTRSADKVLDLSGYERP
FT                   EDTTASITLRTQQPFVFVGVEDGLAEEITGWDRRWERLEKPGAWRRAD"
     MLAELPPEII QLITSYLPSA SALVNLSRTC WRLHHVVAAQ DWRIFRSFVE TKFPGVETPE        60
     IWREAAQALT SRSRALDKHA VVGRFVVPAS EAVKVGSHSS TRRDNPTHGY RPALDSYEVW       120
     NGSSWNDRKE VLAWGAADEL VLRIAEPGPN SKGKWVVFND LDHISSHDDI CGVHILRPGH       180
     PSKEPQTEHI VVARARGELF HLSIDPNIAC HIYKQRFMTS GGGIERTDMS DGKDPILSAH       240
     LSDGSISFFS TTSGEAEVYP FARLNADSSN NATISSRHKY SKFLSPSLFA VGTGRIHDAI       300
     TISAITPQGL SPSRELNVEL VDFERLNLDT TIRSNVNAIA PLDPTGQVFL AAWGDRAIRY       360
     NHPICHYSTL YANTLRLHDL RSNEEYEKTY RDTTDQNPIY CIHPFGHDRF VVGAGGDALV       420
     KIFDLRMPKH DTYSYRDARP SRTLLKNNEP IVDSLSSLSL TATNNSIAFP RKDISIFLSA       480
     HPPSSRPQGR RRHNTRSYRG AIYSMTSPSP SSPTIYTGVA DGVVRLDFAS TDDLLGPCQD       540
     WYREPLLLSN DVRLENTVAH TRSADKVLDL SGYERPEDTT ASITLRTQQP FVFVGVEDGL       600
     AEEITGWDRR WERLEKPGAW RRAD                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page