(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE31

ASPNC_1.PE31         Location/Qualifiers
FT   CDS             join(81209..81435,81543..82518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000174670" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874694"
FT                   /orf_name="An01g00340"
FT                   /product="Similarity to hypothetical protein SPCC320.08 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK43425.1"
FT                   /db_xref="HOGENOM:HBG329870"
FT                   /db_xref="InterPro:IPR009262"
FT                   /db_xref="UniParc:UPI0000EF9F1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E1"
FT                   /transl_table=1
FT                   /translation="MSADNEKSAAVADVQPQPEYSTEKTEQVHTVTETSEQTSQPHDQE
FT                   AQQEQQPTQGRAARLFAYMKTRDFWLVLILGQIIALADISSSTFSTLLSNAGNSIPAFQ
FT                   TLWIYILLNLVYTSITLYKYGFKKWFQMLYRDCWRYFILAFLDVEGNYFMVLAYRYTSL
FT                   LSAELFSFWTIICVAIISFIFLRVRYHITQYLGIFLACGGLGMLIASDYLRGANYPAED
FT                   QVKGDLFALLACTIYAFSNLFEEFMVSKRPMYEVVGQMGFWGMFINGVQCAIFDRSSFH
FT                   GATWDKKVGGYIAGYTIVLFIFYTLAPIMLRVSSAMFFNISLLTMNFWGLIIGIQVFHY
FT                   SVQFLYPIAFVLIVIGLFVYFIMEGEMGEAKKPWLGKDQERGVDGVGTGRRAQQTGHAI
FT                   V"
     MSADNEKSAA VADVQPQPEY STEKTEQVHT VTETSEQTSQ PHDQEAQQEQ QPTQGRAARL        60
     FAYMKTRDFW LVLILGQIIA LADISSSTFS TLLSNAGNSI PAFQTLWIYI LLNLVYTSIT       120
     LYKYGFKKWF QMLYRDCWRY FILAFLDVEG NYFMVLAYRY TSLLSAELFS FWTIICVAII       180
     SFIFLRVRYH ITQYLGIFLA CGGLGMLIAS DYLRGANYPA EDQVKGDLFA LLACTIYAFS       240
     NLFEEFMVSK RPMYEVVGQM GFWGMFINGV QCAIFDRSSF HGATWDKKVG GYIAGYTIVL       300
     FIFYTLAPIM LRVSSAMFFN ISLLTMNFWG LIIGIQVFHY SVQFLYPIAF VLIVIGLFVY       360
     FIMEGEMGEA KKPWLGKDQE RGVDGVGTGR RAQQTGHAIV                             400
//

If you have problems or comments...

PBIL Back to PBIL home page