(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE310

ASPNC_1.PE310        Location/Qualifiers
FT   CDS             join(787507..787881,787943..789046,789321..789626)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211600" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654268"
FT                   /orf_name="An01g03270"
FT                   /product="Similarity to hypothetical conserved protein
FT                   B24M22.130 - Neurospora crassa"
FT                   /protein_id="CAK43693.1"
FT                   /db_xref="HOGENOM:HBG329871"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniParc:UPI0000EF9D7D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q870"
FT                   /transl_table=1
FT                   /translation="MSRRHVSAFYTNTVAPVCAPRRQSIPLSRCFSVGSVRRTAASSKP
FT                   GEQHENTKTQDETKEEEQGAMARRLSDMTEQAMLEGGRSAQRNMQQAGFSDELKQQLEE
FT                   RVAAAAFKNEYATAHSIVDMPSSAGQGTRDIAGAPAWTGTENTHDITLRMLDDSKKRIR
FT                   TPYKIPQPNPVDMRISPKPKESAGLRLAKARERRATYSLSQSEGISEDEREAMRREMRE
FT                   RFSPGARPMPATLQGLSALANERIEDAMARGQFNRIRRGKGVNTETDHRANSPFIDTTE
FT                   YFMNKMIQKQEIVPPWIEKQQDLAREVDRFRSRLRAEWRRHAARLIASEGGSLDIQMRR
FT                   AGAYAAAEARLAERAKIEQAFRESDSASSSGGLDSSDGAPQSSDSTVSGPQEDKDPLPY
FT                   VTPLRDPQYMNTERSFLELTIKNLNALTRTYNLQAPPVAQKPYLNLERELAACYAEVAP
FT                   SLAEEIKRRATERARPKNSGPQAANILESLSTSSKRRSRRLDTYCQTIPYLFDHGISVN
FT                   NPIYLTSSTAAPNHSVPVPQAPHRVQSANPDDCQQHITRCPQNSQEKRDSSIRPQTHQV
FT                   MSKIKSQYPGSKAVYERD"
     MSRRHVSAFY TNTVAPVCAP RRQSIPLSRC FSVGSVRRTA ASSKPGEQHE NTKTQDETKE        60
     EEQGAMARRL SDMTEQAMLE GGRSAQRNMQ QAGFSDELKQ QLEERVAAAA FKNEYATAHS       120
     IVDMPSSAGQ GTRDIAGAPA WTGTENTHDI TLRMLDDSKK RIRTPYKIPQ PNPVDMRISP       180
     KPKESAGLRL AKARERRATY SLSQSEGISE DEREAMRREM RERFSPGARP MPATLQGLSA       240
     LANERIEDAM ARGQFNRIRR GKGVNTETDH RANSPFIDTT EYFMNKMIQK QEIVPPWIEK       300
     QQDLAREVDR FRSRLRAEWR RHAARLIASE GGSLDIQMRR AGAYAAAEAR LAERAKIEQA       360
     FRESDSASSS GGLDSSDGAP QSSDSTVSGP QEDKDPLPYV TPLRDPQYMN TERSFLELTI       420
     KNLNALTRTY NLQAPPVAQK PYLNLERELA ACYAEVAPSL AEEIKRRATE RARPKNSGPQ       480
     AANILESLST SSKRRSRRLD TYCQTIPYLF DHGISVNNPI YLTSSTAAPN HSVPVPQAPH       540
     RVQSANPDDC QQHITRCPQN SQEKRDSSIR PQTHQVMSKI KSQYPGSKAV YERD             594
//

If you have problems or comments...

PBIL Back to PBIL home page