(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE314

ASPNC_1.PE314        Location/Qualifiers
FT   CDS             join(complement(797833..798091),complement(796670..797529))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211633" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877845"
FT                   /orf_name="An01g03310"
FT                   /product="Putative frameshift"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK32620.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG326214"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9D7F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q874"
FT                   /transl_table=1
FT                   /translation="MPLTILSQTQLRSLLLSLSRDQIIELQQNLSNALRDYSTGSQEKG
FT                   CAAAYQPTRTAITRQNGCTTLFMPASTGNTLGMKMISLQDNMTLIDETSLPFGLINAHE
FT                   LTPFRTALTATMTLNKRKRVRTVVVFGAGKQAYWHIRLALILRGEGIKRVYIINRSFDR
FT                   AAQLLRDIYSPENASWRGDVKFSAVSTDFVEYDRILHDALLKADAIFCCTPSTEPLFPA
FT                   QILTSRDGRRKGRLISAIGSYRPHMTELPPELLRDEVTVHSSHRHFHKHVRRSGVVVVD
FT                   SLDAALKEAGEIVQAGIRPHQVVELGELLIVRDASRGEGDNSEDGKSLRDWVERGNVIF
FT                   KSVGMGLMDLVTGGDLVRLAREKGVGTTLEEF"
     MPLTILSQTQ LRSLLLSLSR DQIIELQQNL SNALRDYSTG SQEKGCAAAY QPTRTAITRQ        60
     NGCTTLFMPA STGNTLGMKM ISLQDNMTLI DETSLPFGLI NAHELTPFRT ALTATMTLNK       120
     RKRVRTVVVF GAGKQAYWHI RLALILRGEG IKRVYIINRS FDRAAQLLRD IYSPENASWR       180
     GDVKFSAVST DFVEYDRILH DALLKADAIF CCTPSTEPLF PAQILTSRDG RRKGRLISAI       240
     GSYRPHMTEL PPELLRDEVT VHSSHRHFHK HVRRSGVVVV DSLDAALKEA GEIVQAGIRP       300
     HQVVELGELL IVRDASRGEG DNSEDGKSLR DWVERGNVIF KSVGMGLMDL VTGGDLVRLA       360
     REKGVGTTLE EF                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page