(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE316

ASPNC_1.PE316        Location/Qualifiers
FT   CDS             complement(799765..801063)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000211223" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111055"
FT                   /orf_name="An01g03330"
FT                   /product="Complex: interaction of A. nidulans pclA with a
FT                   PSTAIRE kinase was shown in vivo"
FT                   /function="kinase activity"
FT                   /function="protein kinase binding"
FT                   /biological_process="regulation of cell division "
FT                   /biological_process="regulation of cyclin-dependent protein
FT                   kinase activity"
FT                   /protein_id="CAK36873.1"
FT                   /db_xref="GO:0000079"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0019901"
FT                   /db_xref="GO:0051302"
FT                   /db_xref="HOGENOM:HBG329874"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR012104"
FT                   /db_xref="UniParc:UPI0000EF9D81"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q876"
FT                   /transl_table=1
FT                   /translation="MAVHPYSPCTNFASPTTNTTSIMDFDRAALHEFIMQPVSRDMISH
FT                   LAQQAMQVIRCEPHVTAHHAHGQPTPPSTPPLDADLPPLPSVTTFITSLVLRSQVQVPT
FT                   LMTSLVYLARLRARLPPVAKGMRCTVHRIFLASLILAAKNLNDSSPKNKHWARYTSVRG
FT                   YEGFGFSLPEVNLMERQLLFLLDWDIRVDEADLLHHLEPFLMPIRRRLQIQEQRQREAQ
FT                   LRQPREWRRFHASADLFAARLHRQKAEGRRMPGESPTRRRLPPSPASSASLSSVSSGSS
FT                   YCASPASVAESERYRPYPPRRRPSTRSHASISSPPAVQEVPGLSRAETLPSLSSRASSI
FT                   APSSRSDTPASLRTSSSITSMNEVHVVDGTRSPSVSNGYVSLAGTKVEELSQPNKKARH
FT                   SLSHAHGPGQTHPGFVARFLASAAGSYMGGRRH"
     MAVHPYSPCT NFASPTTNTT SIMDFDRAAL HEFIMQPVSR DMISHLAQQA MQVIRCEPHV        60
     TAHHAHGQPT PPSTPPLDAD LPPLPSVTTF ITSLVLRSQV QVPTLMTSLV YLARLRARLP       120
     PVAKGMRCTV HRIFLASLIL AAKNLNDSSP KNKHWARYTS VRGYEGFGFS LPEVNLMERQ       180
     LLFLLDWDIR VDEADLLHHL EPFLMPIRRR LQIQEQRQRE AQLRQPREWR RFHASADLFA       240
     ARLHRQKAEG RRMPGESPTR RRLPPSPASS ASLSSVSSGS SYCASPASVA ESERYRPYPP       300
     RRRPSTRSHA SISSPPAVQE VPGLSRAETL PSLSSRASSI APSSRSDTPA SLRTSSSITS       360
     MNEVHVVDGT RSPSVSNGYV SLAGTKVEEL SQPNKKARHS LSHAHGPGQT HPGFVARFLA       420
     SAAGSYMGGR RH                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page