(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE319

ASPNC_1.PE319        Location/Qualifiers
FT   CDS             join(805910..806728,806951..807157)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000225864" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111056"
FT                   /gene_name="ncs6"
FT                   /gene_synonym="ctu1"
FT                   /orf_name="An01g03360"
FT                   /product="Cytoplasmic tRNA 2-thiolation protein 1 "
FT                   /EC_number="2.7.7.-"
FT                   /function="ATP binding"
FT                   /function="tRNA binding"
FT                   /function="transferase activity"
FT                   /biological_process="tRNA thio-modification"
FT                   /biological_process="tRNA wobble uridine modification "
FT                   /cellular_component="cytosol"
FT                   /protein_id="CAK36876.1"
FT                   /db_xref="GO:0000049"
FT                   /db_xref="GO:0002098"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0005829"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0034227"
FT                   /db_xref="HOGENOM:HBG541846"
FT                   /db_xref="InterPro:IPR000541"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniParc:UPI0000EF9D9D"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q879"
FT                   /transl_table=1
FT                   /translation="MPPSPCARCHDQRAVIIRPKNRQKLCRTCFLHVFETEVHETITST
FT                   SLFHPGERVAIGASGGKDSTVLAAVLKTLNERYNYGLDLCLLSIDEGIKGYRDDSLETV
FT                   KRNAQQYNMPLVIVSYGDLYGWTMDQVVAQVGKKGNCTYCGVFRRQALDRGAAKLGIKH
FT                   VVTGHNADDVAETVMMNLLRGDLPRLSRGTSIVTGSAASDIKRSKPLKYAYEKEIVLYA
FT                   HHRQLDYFSTECIYSPEAFRGSARTLIKDLEKIRPSSILDIVKSGEDMALLKKVKSQVL
FT                   GTCERCGYISSQRVCKACTLLEGLNKNRPKTAIEMEIGLEDEESSSTLRRQMEKVELGG
FT                   V"
     MPPSPCARCH DQRAVIIRPK NRQKLCRTCF LHVFETEVHE TITSTSLFHP GERVAIGASG        60
     GKDSTVLAAV LKTLNERYNY GLDLCLLSID EGIKGYRDDS LETVKRNAQQ YNMPLVIVSY       120
     GDLYGWTMDQ VVAQVGKKGN CTYCGVFRRQ ALDRGAAKLG IKHVVTGHNA DDVAETVMMN       180
     LLRGDLPRLS RGTSIVTGSA ASDIKRSKPL KYAYEKEIVL YAHHRQLDYF STECIYSPEA       240
     FRGSARTLIK DLEKIRPSSI LDIVKSGEDM ALLKKVKSQV LGTCERCGYI SSQRVCKACT       300
     LLEGLNKNRP KTAIEMEIGL EDEESSSTLR RQMEKVELGG V                           341
//

If you have problems or comments...

PBIL Back to PBIL home page