(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE321

ASPNC_1.PE321        Location/Qualifiers
FT   CDS             join(complement(815147..815217),complement(814577..815075))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211268" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877848"
FT                   /orf_name="An01g03390"
FT                   /product="Similarity to hypothetical protein CAD21197.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36878.1"
FT                   /db_xref="HOGENOM:HBG329876"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="UniParc:UPI0000EF9D9F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q881"
FT                   /transl_table=1
FT                   /translation="MPGTCEVCVSEPSKYRCPTCGLMSCSLACTQSHKIYCAPKAPSPK
FT                   PTGPTVDIQQPPGESNEHAASEITPKAQNGLDIKALGSSTELKDLLDRFPSLREELYDI
FT                   YKTTLEDAWVETQRFGGRGRHHGRGKGPHRHNGPWTREKGFNRGVGRVRRLRERCEEGL
FT                   ETGKKAEGYVRFMSLVTGNELPRETM"
     MPGTCEVCVS EPSKYRCPTC GLMSCSLACT QSHKIYCAPK APSPKPTGPT VDIQQPPGES        60
     NEHAASEITP KAQNGLDIKA LGSSTELKDL LDRFPSLREE LYDIYKTTLE DAWVETQRFG       120
     GRGRHHGRGK GPHRHNGPWT REKGFNRGVG RVRRLRERCE EGLETGKKAE GYVRFMSLVT       180
     GNELPRETM                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page