(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE322

ASPNC_1.PE322        Location/Qualifiers
FT   CDS             join(815743..815802,815891..816418,816483..816623,
FT                   816777..817553)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234474" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111057"
FT                   /orf_name="An01g03400"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36879.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0000EF9DA0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q882"
FT                   /transl_table=1
FT                   /translation="MGGIPFRSTGCNTCRRRKVKCDEAKPECNRCIKNGHVCTGYERKR
FT                   VFIHKSSEAIEEGELKLVRRPQSTSGKIPDRQLTRVEPGFPRLNNNAEVRSQLLASFVG
FT                   GFLPSSRHLQDGKDTNILKTLPELCGNSPLLDRALLSLSSAFLAKQHKDDRLLGYSTKL
FT                   YNNSMEIMHGKIKSGKGLGQDVLYTTVVFQLYELIHSSPPGFMAWIAHVQGSNAIIKQC
FT                   RVNKKGTIAEKLFHRQLKFVTGSTELEPIDELMDLLAECSALIEQVDTFIEQLPASPDG
FT                   DKNNGEKLLGSCLSLEERLHQTCLKMQEKLGAPSTLTHDVPLREDLRAHLATSLFPDPF
FT                   QFVSLACAESHLIYWATLIILYPLVDELLDVLGYRRNDVTPSQSCAIHPQAIEQRPLGV
FT                   DVATDFTALAEHYADEVCRSVMYCTQSDMNTLGAQHLLAPFSQCAQFFQVHELAQKYRW
FT                   CQGVFVLLDSLGLGIAPLLKDMVWPQYRSARLRRSLSSVGKVP"
     MGGIPFRSTG CNTCRRRKVK CDEAKPECNR CIKNGHVCTG YERKRVFIHK SSEAIEEGEL        60
     KLVRRPQSTS GKIPDRQLTR VEPGFPRLNN NAEVRSQLLA SFVGGFLPSS RHLQDGKDTN       120
     ILKTLPELCG NSPLLDRALL SLSSAFLAKQ HKDDRLLGYS TKLYNNSMEI MHGKIKSGKG       180
     LGQDVLYTTV VFQLYELIHS SPPGFMAWIA HVQGSNAIIK QCRVNKKGTI AEKLFHRQLK       240
     FVTGSTELEP IDELMDLLAE CSALIEQVDT FIEQLPASPD GDKNNGEKLL GSCLSLEERL       300
     HQTCLKMQEK LGAPSTLTHD VPLREDLRAH LATSLFPDPF QFVSLACAES HLIYWATLII       360
     LYPLVDELLD VLGYRRNDVT PSQSCAIHPQ AIEQRPLGVD VATDFTALAE HYADEVCRSV       420
     MYCTQSDMNT LGAQHLLAPF SQCAQFFQVH ELAQKYRWCQ GVFVLLDSLG LGIAPLLKDM       480
     VWPQYRSARL RRSLSSVGKV P                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page