(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE330

ASPNC_1.PE330        Location/Qualifiers
FT   CDS             join(839882..840294,840368..840896)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211290" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877854"
FT                   /orf_name="An01g03490"
FT                   /product="Similarity to hypothetical protein CAE76442.1 -
FT                   Neurospora crassa"
FT                   /protein_id="CAK36887.1"
FT                   /db_xref="HOGENOM:HBG329882"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010414"
FT                   /db_xref="UniParc:UPI0000EF9DA7"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q890"
FT                   /transl_table=1
FT                   /translation="MVKPLTFKGDKPKKRKHTSTSTSTDPSHPAKKQSTSTSTPTANEA
FT                   EDPSTHDEHTLSDQSWVSADTSSDISGPILLILRTTPPTCLATDAHGTVFASALENMIE
FT                   GDPRTAEPHDVRQVWIASKIAGIEGWSLKGSNGRYLTSDKHGILSANASAISQHEIYTI
FT                   SESGAGGGGFFVFGTGTGASSASQGGDGVDDKEKKEKKQTYLVARTVASKTTASGTKVE
FT                   IRGDETTLDDGEEDGGGTNIRVRMQARFKPRIQASKEIKAREKIGRKELEGIVGRRLDD
FT                   DEVKRLRKARKEGDFHEVVLDVRVRGKHDKFA"
     MVKPLTFKGD KPKKRKHTST STSTDPSHPA KKQSTSTSTP TANEAEDPST HDEHTLSDQS        60
     WVSADTSSDI SGPILLILRT TPPTCLATDA HGTVFASALE NMIEGDPRTA EPHDVRQVWI       120
     ASKIAGIEGW SLKGSNGRYL TSDKHGILSA NASAISQHEI YTISESGAGG GGFFVFGTGT       180
     GASSASQGGD GVDDKEKKEK KQTYLVARTV ASKTTASGTK VEIRGDETTL DDGEEDGGGT       240
     NIRVRMQARF KPRIQASKEI KAREKIGRKE LEGIVGRRLD DDEVKRLRKA RKEGDFHEVV       300
     LDVRVRGKHD KFA                                                          313
//

If you have problems or comments...

PBIL Back to PBIL home page