(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE341

ASPNC_1.PE341        Location/Qualifiers
FT   CDS             join(complement(867756..867834),complement(867384..867659),
FT                   complement(866869..867238),complement(866520..866793),
FT                   complement(866265..866267))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000198833" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877862"
FT                   /orf_name="An01g03600"
FT                   /product="Similarity to casein kinase 1 cki1p -
FT                   Schizosaccharomyces pombe"
FT                   /function="kinase activity"
FT                   /protein_id="CAK36898.1"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI0000EF9DD2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A1"
FT                   /transl_table=1
FT                   /translation="MACACGSATPFPETKKALQIGEVKHTWSNSFSPVTSPSPSKFPPL
FT                   QCYPNSNNHSNSRASIALAPEYSPQNAYIPTTQTASPPDTEPEKPNPGLANNLSSHHDV
FT                   SIAADTPLTHPQMEAHKDILCVSPYFAALCNPPNNDVSSSSPSSSPSSSPSPTESMRQI
FT                   DLPDEQPEIFSCVLEYLYRGDYYPRLRHDKTTNTWDLETTPSSSTNTRTTTNNKDTTDP
FT                   NAIIFHPAVGAEILRDTAVYCAAEKYSLEHLKRLALKKQGLHSNIPCHIILSSARYAYM
FT                   HTPDTESKLRAHYLALIIRSRGTFKRSGTMQMEMERGGKLFFDLFVAMCNHM"
     MACACGSATP FPETKKALQI GEVKHTWSNS FSPVTSPSPS KFPPLQCYPN SNNHSNSRAS        60
     IALAPEYSPQ NAYIPTTQTA SPPDTEPEKP NPGLANNLSS HHDVSIAADT PLTHPQMEAH       120
     KDILCVSPYF AALCNPPNND VSSSSPSSSP SSSPSPTESM RQIDLPDEQP EIFSCVLEYL       180
     YRGDYYPRLR HDKTTNTWDL ETTPSSSTNT RTTTNNKDTT DPNAIIFHPA VGAEILRDTA       240
     VYCAAEKYSL EHLKRLALKK QGLHSNIPCH IILSSARYAY MHTPDTESKL RAHYLALIIR       300
     SRGTFKRSGT MQMEMERGGK LFFDLFVAMC NHM                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page