(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE343

ASPNC_1.PE343        Location/Qualifiers
FT   CDS             join(complement(872593..872604),complement(872452..872502),
FT                   complement(872282..872399),complement(871912..872126))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877863"
FT                   /orf_name="An01g03620"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36900.1"
FT                   /db_xref="UniParc:UPI0000EF9DD4"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A3"
FT                   /transl_table=1
FT                   /translation="MPGAQVSIPYRQNTGKRDTTWNTTLHLDQSILHETQLPRCIQPQL
FT                   NRSSALPQGPYGRSRGGQALFSPGLLKGGNSSEKKTNLEYYPDELTNGQQQDCLRTLNR
FT                   LQNLKAWHLFFQKFLPDPKTKESGQTR"
     MPGAQVSIPY RQNTGKRDTT WNTTLHLDQS ILHETQLPRC IQPQLNRSSA LPQGPYGRSR        60
     GGQALFSPGL LKGGNSSEKK TNLEYYPDEL TNGQQQDCLR TLNRLQNLKA WHLFFQKFLP       120
     DPKTKESGQT R                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page