(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE345

ASPNC_1.PE345        Location/Qualifiers
FT   CDS             join(complement(876225..876322),complement(875920..876103))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211421" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806934"
FT                   /orf_name="An01g03640"
FT                   /function="metal ion binding"
FT                   /biological_process="protein import into mitochondrial
FT                   inner membrane"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /cellular_component="mitochondrial intermembrane space
FT                   protein transporter complex"
FT                   /protein_id="CAK36902.1"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0042719"
FT                   /db_xref="GO:0045039"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="HOGENOM:HBG560646"
FT                   /db_xref="InterPro:IPR004217"
FT                   /db_xref="UniParc:UPI0000EF9DD6"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8A5"
FT                   /transl_table=1
FT                   /translation="MSFLFGGAPKLSSEQKIAAAETEVEMVTDMFSRLTESCIKKCIPN
FT                   DYREGDLNKGESVCIDRCVGKFFEVNMKVSEKMQGEANQKGGMGGFGM"
     MSFLFGGAPK LSSEQKIAAA ETEVEMVTDM FSRLTESCIK KCIPNDYREG DLNKGESVCI        60
     DRCVGKFFEV NMKVSEKMQG EANQKGGMGG FGM                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page