(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE35

ASPNC_1.PE35         Location/Qualifiers
FT   CDS             join(94559..94732,94904..95614)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874696"
FT                   /orf_name="An01g00390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK43429.1"
FT                   /db_xref="UniParc:UPI0000EF9F1D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E5"
FT                   /transl_table=1
FT                   /translation="MIQRLMRSLFTITIFVSKLYNIPFGCDCFVSRCIVHTQPIGSKLS
FT                   ASSDASQEQQKEQLAHPPPCPNVYRPSPTSSERILLTSRQAKAKASSSSPDFSILSPFP
FT                   LPLRVRDCASAPPLAHAAERHNRTTLDHTMSYTSSSRFSRSPSPAPRTRRPSPLERTSL
FT                   HLRLSLLSGEKYDQESSAKEPDLRRCLSHAHIHAKSMAMVKRDIRVHIRSMGMAMDDDS
FT                   DEELLDHEVLPPPPSRRSSRSSSKAAAAPRVTVSPKPSEKSSLLDKGRKCLEKLFPRKN
FT                   NVHLAQSRVTVVT"
     MIQRLMRSLF TITIFVSKLY NIPFGCDCFV SRCIVHTQPI GSKLSASSDA SQEQQKEQLA        60
     HPPPCPNVYR PSPTSSERIL LTSRQAKAKA SSSSPDFSIL SPFPLPLRVR DCASAPPLAH       120
     AAERHNRTTL DHTMSYTSSS RFSRSPSPAP RTRRPSPLER TSLHLRLSLL SGEKYDQESS       180
     AKEPDLRRCL SHAHIHAKSM AMVKRDIRVH IRSMGMAMDD DSDEELLDHE VLPPPPSRRS       240
     SRSSSKAAAA PRVTVSPKPS EKSSLLDKGR KCLEKLFPRK NNVHLAQSRV TVVT             294
//

If you have problems or comments...

PBIL Back to PBIL home page