(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE361

ASPNC_1.PE361        Location/Qualifiers
FT   CDS             join(910576..910662,910827..911120,911202..911258)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877871"
FT                   /orf_name="An01g03800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36918.1"
FT                   /db_xref="UniParc:UPI0000EF9E11"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C1"
FT                   /transl_table=1
FT                   /translation="MTTDPISLDPRSQAWGSEWLIRTTPGGRFPNPRWVINVSSPDSLL
FT                   ARRKCFLSAEVSATTPIGPSRERTMIRNRRLSDKEVSQVMDWFVGAACRSAKSSMALWG
FT                   ADLMIALYQLLHYLLDPATNALGEPTDLALHLRYARSQYCA"
     MTTDPISLDP RSQAWGSEWL IRTTPGGRFP NPRWVINVSS PDSLLARRKC FLSAEVSATT        60
     PIGPSRERTM IRNRRLSDKE VSQVMDWFVG AACRSAKSSM ALWGADLMIA LYQLLHYLLD       120
     PATNALGEPT DLALHLRYAR SQYCA                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page