(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE366

ASPNC_1.PE366        Location/Qualifiers
FT   CDS             join(complement(917669..917715),complement(917509..917586),
FT                   complement(917378..917464),complement(917118..917245),
FT                   complement(916898..917019))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877873"
FT                   /orf_name="An01g03860"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36923.1"
FT                   /db_xref="UniParc:UPI0000EF9E16"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C6"
FT                   /transl_table=1
FT                   /translation="MSGGGVQEVGVLEDDGGICARRMARCRVKEEDGKSRGDAVGLLSP
FT                   MIDGSGLEEVCWRKAEHLRTQNRSPEKYECERWKRKAGRRTIEDDGWNGSERARDRGKT
FT                   EAAVKLSPRCVCGIQGSAGSPDTAMEGKKREKAAMITKIRGGLDDALED"
     MSGGGVQEVG VLEDDGGICA RRMARCRVKE EDGKSRGDAV GLLSPMIDGS GLEEVCWRKA        60
     EHLRTQNRSP EKYECERWKR KAGRRTIEDD GWNGSERARD RGKTEAAVKL SPRCVCGIQG       120
     SAGSPDTAME GKKREKAAMI TKIRGGLDDA LED                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page