(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE367

ASPNC_1.PE367        Location/Qualifiers
FT   CDS             join(918028..918110,918180..918618,918671..918865,
FT                   918920..919210)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211110" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877874"
FT                   /orf_name="An01g03870"
FT                   /product="Similarity to hypothetical protein SPAC23H3.04 -
FT                   Schizosaccharomyces pombe"
FT                   /protein_id="CAK36924.1"
FT                   /db_xref="HOGENOM:HBG329907"
FT                   /db_xref="UniParc:UPI0000EF9E17"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8C7"
FT                   /transl_table=1
FT                   /translation="MYRPNSLWTWSFCIVTLIQTIITLALESYVFANFQIQLFPKGEVS
FT                   TASKTVTTFLALYCFGFIYELILVYDALRLKNTIQVIGLCVCNLGLLIYGAVQVQQIKD
FT                   SIEMLVAESAITIDVWGETEPFLIIIPCVVAMGSILMMIIAWKLYDEFAWSIYKHISAD
FT                   LRMKRRYLTYQIYIALLKFDFFFFLGFTVQFLVIVTNKTDVEFALTTAAIPVTILILVC
FT                   AAIFVKRESSIGMIVVILLYFAAMAYFLFKLVRMYQPQTYQEYLPARRSLTFFAVITLL
FT                   LIVLTITNACVCMHNFHKGLKQHVHKKKSRDKDEKTTELSSNISGQVPNRMMID"
     MYRPNSLWTW SFCIVTLIQT IITLALESYV FANFQIQLFP KGEVSTASKT VTTFLALYCF        60
     GFIYELILVY DALRLKNTIQ VIGLCVCNLG LLIYGAVQVQ QIKDSIEMLV AESAITIDVW       120
     GETEPFLIII PCVVAMGSIL MMIIAWKLYD EFAWSIYKHI SADLRMKRRY LTYQIYIALL       180
     KFDFFFFLGF TVQFLVIVTN KTDVEFALTT AAIPVTILIL VCAAIFVKRE SSIGMIVVIL       240
     LYFAAMAYFL FKLVRMYQPQ TYQEYLPARR SLTFFAVITL LLIVLTITNA CVCMHNFHKG       300
     LKQHVHKKKS RDKDEKTTEL SSNISGQVPN RMMID                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page