(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE37

ASPNC_1.PE37         Location/Qualifiers
FT   CDS             join(100703..100995,101097..101732,101786..101903)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18110315"
FT                   /orf_name="An01g00420"
FT                   /product="Similarity to hypothetical protein encoded by
FT                   An01g01580 - Aspergillus niger"
FT                   /protein_id="CAK43431.1"
FT                   /db_xref="UniParc:UPI0000EF9F1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7E7"
FT                   /transl_table=1
FT                   /translation="MEVAVTHLRTLVGLATRTDPSPLPPVQDIISHIQSLYDSGRPFYT
FT                   KDLLQCIKEQLRGARDGIIQTIRVPGVDEVIVEFPVMTGQVFPTPEQGMELIVRNPCIE
FT                   YLSVQELLQDCDLRDDNLAYNHIQIGHYRFLRNIHTKELYSDLSVASVPDASELLRRSS
FT                   RIWENTAQCQALRAILMSRKDISISRIVGLALGSFATVYPSLQDRSAFQHALLLTLRDI
FT                   SCNMQNIAQQSIPCFAQDPMCNIVDITAAEEAGITILEDTDGFLEIDDSTVVFSCAPDI
FT                   PVRQIVLDLARPAVLIWDKLRNEDDDDHSADPASPRVMTCLRNIYEEFEFPDYDKHFGD
FT                   LAVYIRRN"
     MEVAVTHLRT LVGLATRTDP SPLPPVQDII SHIQSLYDSG RPFYTKDLLQ CIKEQLRGAR        60
     DGIIQTIRVP GVDEVIVEFP VMTGQVFPTP EQGMELIVRN PCIEYLSVQE LLQDCDLRDD       120
     NLAYNHIQIG HYRFLRNIHT KELYSDLSVA SVPDASELLR RSSRIWENTA QCQALRAILM       180
     SRKDISISRI VGLALGSFAT VYPSLQDRSA FQHALLLTLR DISCNMQNIA QQSIPCFAQD       240
     PMCNIVDITA AEEAGITILE DTDGFLEIDD STVVFSCAPD IPVRQIVLDL ARPAVLIWDK       300
     LRNEDDDDHS ADPASPRVMT CLRNIYEEFE FPDYDKHFGD LAVYIRRN                    348
//

If you have problems or comments...

PBIL Back to PBIL home page