(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE370

ASPNC_1.PE370        Location/Qualifiers
FT   CDS             join(complement(926270..926482),complement(926033..926182))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806937"
FT                   /orf_name="An01g03910"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36927.1"
FT                   /db_xref="UniParc:UPI0000EF9E1A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D0"
FT                   /transl_table=1
FT                   /translation="MARKHCEYTITYGYGRSNNLQQGEFEIKHKELLNEVFIHSTALWN
FT                   VSFTARYLLITRVFICGTAIPNPRRPPKWIPYRGLIVDHRRVGGPISRDRVGGLGVASR
FT                   QYFPSLLSLGPGTTPA"
     MARKHCEYTI TYGYGRSNNL QQGEFEIKHK ELLNEVFIHS TALWNVSFTA RYLLITRVFI        60
     CGTAIPNPRR PPKWIPYRGL IVDHRRVGGP ISRDRVGGLG VASRQYFPSL LSLGPGTTPA       120
//

If you have problems or comments...

PBIL Back to PBIL home page