(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE373

ASPNC_1.PE373        Location/Qualifiers
FT   CDS             join(930778..930794,930868..930907,930951..931074,
FT                   931133..931296,931339..931468,931533..932035)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142393" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877877"
FT                   /orf_name="An01g03940"
FT                   /product="Similarity to hypothetical protein EAA64320.1 -
FT                   Aspergillus nidulans"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAK36930.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG532399"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9E1D"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D3"
FT                   /transl_table=1
FT                   /translation="MTTVFITGASGYIGGDLLSSEAATAARKIKAQYPTVEIIQGSLDD
FT                   SETLVAESARADIIIPDFTGMKDTADAADHLGAAKAIAQGALEGHTEEHPVYWLHTSGA
FT                   GIFSFLDTETKDIKEIVNFPDHAFHRDVDKAVFEAGSVRPEVLKTAIISPVTVYGQGRG
FT                   PCSQRSRQIYELAKLTIQRQKVPIIGRGLSFGTDIHIYDLTNLYVILFERALSKQDDGL
FT                   WGPEAYYLCENGEHCWGELARSIGRICVAEGFIPSAEEEAFGFEEAQKWAGYEAASWGL
FT                   NSRCRASRARLLLGWQPSAPSLESELRDIVKGEYRRLQEAERDA"
     MTTVFITGAS GYIGGDLLSS EAATAARKIK AQYPTVEIIQ GSLDDSETLV AESARADIII        60
     PDFTGMKDTA DAADHLGAAK AIAQGALEGH TEEHPVYWLH TSGAGIFSFL DTETKDIKEI       120
     VNFPDHAFHR DVDKAVFEAG SVRPEVLKTA IISPVTVYGQ GRGPCSQRSR QIYELAKLTI       180
     QRQKVPIIGR GLSFGTDIHI YDLTNLYVIL FERALSKQDD GLWGPEAYYL CENGEHCWGE       240
     LARSIGRICV AEGFIPSAEE EAFGFEEAQK WAGYEAASWG LNSRCRASRA RLLLGWQPSA       300
     PSLESELRDI VKGEYRRLQE AERDA                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page