(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE374

ASPNC_1.PE374        Location/Qualifiers
FT   CDS             join(complement(934711..934759),complement(934450..934649),
FT                   complement(933907..934388),complement(933400..933851),
FT                   complement(932684..933348))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000211077" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877878"
FT                   /orf_name="An01g03950"
FT                   /product="Similarity to hypothetical protein CAE76289.1 -
FT                   Neurospora crassa"
FT                   /function="DNA binding"
FT                   /function="DNA polymerase processivity factor activity "
FT                   /biological_process="regulation of DNA replication "
FT                   /cellular_component="PCNA complex"
FT                   /protein_id="CAK36931.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0006275"
FT                   /db_xref="GO:0030337"
FT                   /db_xref="GO:0043626"
FT                   /db_xref="HOGENOM:HBG329912"
FT                   /db_xref="UniParc:UPI0000EF9E1E"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D4"
FT                   /transl_table=1
FT                   /translation="MESLVYENSPLADYLQGEGEHDPSWPVKEADHSDDFSDSTAADFA
FT                   PRGVSKFQERIRNKLPKPLERKVSRQRAALGRLYDVCTSALNSRVGRSDNERFLEQFGY
FT                   VIVASQLLNEHSAPSYTSAADVMSTALPADLPSISTTFGIQGAVVTASTSFSVAWLLHW
FT                   SRSRTSSGLNPRKVGVLLVLVPVIGVLFYAFAKRQWLKYLRHQAVDAAVTFISNAQGFD
FT                   SAASASVVFIQEVELVSRGYRISTPLPPVSRLEDQTQTRRCLRLRRTVSESFYLMLGQY
FT                   IRAQHTLRPLTDATNLAKYYDIYDISEEELMEAEAAFDERATEDQYSLRALRTLFGRLY
FT                   IVRKSILCCLLALGADGGGSDIARWTTAVEQMRDLAHVTGENIHKMTNILNEDDRDVIP
FT                   PSPLPTASPNKDNLRAQYRNINSLSQGIRALHAKMHILKEASSSNLERPDAGEFEASLM
FT                   PQYESIGADIRSLLQEWESGKSALMSSLGKPANPEFSRPSSFLKTPLSPTPSLGGSTAV
FT                   EGSPADALRALTGENTDPSIVHTLDDEEEIFEAVALPARNKRMSLTREERIARVKEDRA
FT                   RQAAARERTDANTNMLKELEMVIKQRPRTTIAAKRVTSI"
     MESLVYENSP LADYLQGEGE HDPSWPVKEA DHSDDFSDST AADFAPRGVS KFQERIRNKL        60
     PKPLERKVSR QRAALGRLYD VCTSALNSRV GRSDNERFLE QFGYVIVASQ LLNEHSAPSY       120
     TSAADVMSTA LPADLPSIST TFGIQGAVVT ASTSFSVAWL LHWSRSRTSS GLNPRKVGVL       180
     LVLVPVIGVL FYAFAKRQWL KYLRHQAVDA AVTFISNAQG FDSAASASVV FIQEVELVSR       240
     GYRISTPLPP VSRLEDQTQT RRCLRLRRTV SESFYLMLGQ YIRAQHTLRP LTDATNLAKY       300
     YDIYDISEEE LMEAEAAFDE RATEDQYSLR ALRTLFGRLY IVRKSILCCL LALGADGGGS       360
     DIARWTTAVE QMRDLAHVTG ENIHKMTNIL NEDDRDVIPP SPLPTASPNK DNLRAQYRNI       420
     NSLSQGIRAL HAKMHILKEA SSSNLERPDA GEFEASLMPQ YESIGADIRS LLQEWESGKS       480
     ALMSSLGKPA NPEFSRPSSF LKTPLSPTPS LGGSTAVEGS PADALRALTG ENTDPSIVHT       540
     LDDEEEIFEA VALPARNKRM SLTREERIAR VKEDRARQAA ARERTDANTN MLKELEMVIK       600
     QRPRTTIAAK RVTSI                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page