(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE375

ASPNC_1.PE375        Location/Qualifiers
FT   CDS             join(complement(935655..935718),complement(935412..935610),
FT                   complement(935166..935322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960198"
FT                   /orf_name="An01g03960"
FT                   /product="Similarity to hypothetical kinesin-like protein
FT                   klp-7 - Caenorhabditis elegans"
FT                   /protein_id="CAK36932.1"
FT                   /db_xref="UniParc:UPI0000EF9E1F"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D5"
FT                   /transl_table=1
FT                   /translation="MVTSEIPRGLQHMLDAETSVCRESQSTDLDHPLANLCDHRLNPLG
FT                   SLGCTPSRALTGWKTRLAVPWRNNPPDRIEANDSHKGKSPPKRKRQLRFEQKREAQAIQ
FT                   FPRHTHGLIFNVAAAQAPSFGLPLCSLTSVSICQG"
     MVTSEIPRGL QHMLDAETSV CRESQSTDLD HPLANLCDHR LNPLGSLGCT PSRALTGWKT        60
     RLAVPWRNNP PDRIEANDSH KGKSPPKRKR QLRFEQKREA QAIQFPRHTH GLIFNVAAAQ       120
     APSFGLPLCS LTSVSICQG                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page