(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE378

ASPNC_1.PE378        Location/Qualifiers
FT   CDS             join(complement(942203..942318),complement(942062..942110),
FT                   complement(941956..941989),complement(941718..941874),
FT                   complement(941548..941661),complement(941425..941491))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111063"
FT                   /orf_name="An01g03990"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36935.1"
FT                   /db_xref="UniParc:UPI0000EF9E22"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D8"
FT                   /transl_table=1
FT                   /translation="MPSTIPNTWANDCDCGIEDGGGISKVETGRSEKEYPPGRGKERAT
FT                   RLRCSLNRLDDVHRRDDTKSEATPASKEHLAIPSEPAIDRSFLRRTPEGASPDGGVAVS
FT                   ANNNPAIKVRSRQHRAFAARLLYAVREGSQSPLAIDLVIGQGGGETKDRKEETAAADDY
FT                   LLTSLRIRSLIQNSI"
     MPSTIPNTWA NDCDCGIEDG GGISKVETGR SEKEYPPGRG KERATRLRCS LNRLDDVHRR        60
     DDTKSEATPA SKEHLAIPSE PAIDRSFLRR TPEGASPDGG VAVSANNNPA IKVRSRQHRA       120
     FAARLLYAVR EGSQSPLAID LVIGQGGGET KDRKEETAAA DDYLLTSLRI RSLIQNSI         178
//

If you have problems or comments...

PBIL Back to PBIL home page