(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE379

ASPNC_1.PE379        Location/Qualifiers
FT   CDS             join(942391..942721,942772..942830)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806939"
FT                   /orf_name="An01g04000"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36936.1"
FT                   /db_xref="UniParc:UPI0000EF9E23"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8D9"
FT                   /transl_table=1
FT                   /translation="MCRGRTVGRPLLLRTPGKTGDRPLPLSWGSSSQTLAHSSATGVVR
FT                   NLAVIILAAILRRTGGKVTGRCQELPWNVQRGGMSIEQGAVETGTTRFFYSASQLKGSL
FT                   IFMVAWVGIVTLPRGCDVCDVEGFG"
     MCRGRTVGRP LLLRTPGKTG DRPLPLSWGS SSQTLAHSSA TGVVRNLAVI ILAAILRRTG        60
     GKVTGRCQEL PWNVQRGGMS IEQGAVETGT TRFFYSASQL KGSLIFMVAW VGIVTLPRGC       120
     DVCDVEGFG                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page