(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE380

ASPNC_1.PE380        Location/Qualifiers
FT   CDS             join(complement(943311..943434),complement(943098..943144))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111064"
FT                   /orf_name="An01g04010"
FT                   /product="Similarity to protein SEQ ID NO:5110 from patent
FT                   EP1033405-A2 - Zea mays"
FT                   /protein_id="CAK36937.1"
FT                   /db_xref="UniParc:UPI0000EF9E32"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E0"
FT                   /transl_table=1
FT                   /translation="MIDGWGSWTRSIGESSLTPLAVELNPPPDIRHSIHGFYADKRIGY
FT                   TKDKMVANAAI"
     MIDGWGSWTR SIGESSLTPL AVELNPPPDI RHSIHGFYAD KRIGYTKDKM VANAAI            56
//

If you have problems or comments...

PBIL Back to PBIL home page