(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE381

ASPNC_1.PE381        Location/Qualifiers
FT   CDS             join(complement(949208..949268),complement(948985..949125),
FT                   complement(948647..948730),complement(948222..948467),
FT                   complement(947999..948129),complement(947566..947733),
FT                   complement(947207..947323),complement(946910..946965),
FT                   complement(946712..946865),complement(946434..946496),
FT                   complement(946010..946069),complement(945809..945907),
FT                   complement(945543..945640),complement(945181..945440),
FT                   complement(944542..944768))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877881"
FT                   /orf_name="An01g04020"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36938.1"
FT                   /db_xref="UniParc:UPI0000EF9E33"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E1"
FT                   /transl_table=1
FT                   /translation="MHSRYRSIVALIDPEGGNEGCPRKGEERQVCGQEMDLRLLQRLAA
FT                   QRAPEEEDASKEFRRCNVLAVLAKRRAGKKAQPQRVNDDSQGKRGGRAAPGGRETLSPT
FT                   NPAKPRPTLSFSSPNPCMLRFLRLRDAGQYQYLGILYAPVNTQPSCYLLVGNYRQAKTP
FT                   SWREEAPSHKGLEKRVTGFVTSRFHPWGKPAPKYKKQKTMRHFGGWLPRRANLDLTNPS
FT                   KERLSDKEGGYSMRRNEPPRGQDSAGARAGIIAARAATVVCGKVALPTVGAGNARVPRR
FT                   SYLFRLIRSVAAPGIHTTHHHPTYSIHSTPNQTNMLGLNLVVPDPESDGLGPVTLSQSE
FT                   AVVTSTVGASRVMPMMRARTTNLPACYRHHWELRTNCKRSLDDSIPRLAMGQAGGFHVF
FT                   NLPRSPLKPSSCLPPGNSTVIIPGMVTQAFPTRKAQHVQRVAVMESVRGKKEAGKPIGI
FT                   GLIVSGRMETRKREKKQYGDDDQIHARWQSNWDKRVAISKAETIERANSTPSTTNGLTI
FT                   KKPAHPRSLRMGGAARLLNASRSLQVLGQASCDSGITPTQCHGCSGRCSFPQSQQPICA
FT                   SREFLSEGSSSMTANTDSPHLDREQDTRYMLLMYTYVPNTSGICATRPRSQDRNRLSAN
FT                   KLRPSTERKNRIRNINYIQ"
     MHSRYRSIVA LIDPEGGNEG CPRKGEERQV CGQEMDLRLL QRLAAQRAPE EEDASKEFRR        60
     CNVLAVLAKR RAGKKAQPQR VNDDSQGKRG GRAAPGGRET LSPTNPAKPR PTLSFSSPNP       120
     CMLRFLRLRD AGQYQYLGIL YAPVNTQPSC YLLVGNYRQA KTPSWREEAP SHKGLEKRVT       180
     GFVTSRFHPW GKPAPKYKKQ KTMRHFGGWL PRRANLDLTN PSKERLSDKE GGYSMRRNEP       240
     PRGQDSAGAR AGIIAARAAT VVCGKVALPT VGAGNARVPR RSYLFRLIRS VAAPGIHTTH       300
     HHPTYSIHST PNQTNMLGLN LVVPDPESDG LGPVTLSQSE AVVTSTVGAS RVMPMMRART       360
     TNLPACYRHH WELRTNCKRS LDDSIPRLAM GQAGGFHVFN LPRSPLKPSS CLPPGNSTVI       420
     IPGMVTQAFP TRKAQHVQRV AVMESVRGKK EAGKPIGIGL IVSGRMETRK REKKQYGDDD       480
     QIHARWQSNW DKRVAISKAE TIERANSTPS TTNGLTIKKP AHPRSLRMGG AARLLNASRS       540
     LQVLGQASCD SGITPTQCHG CSGRCSFPQS QQPICASREF LSEGSSSMTA NTDSPHLDRE       600
     QDTRYMLLMY TYVPNTSGIC ATRPRSQDRN RLSANKLRPS TERKNRIRNI NYIQ             654
//

If you have problems or comments...

PBIL Back to PBIL home page