(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE383

ASPNC_1.PE383        Location/Qualifiers
FT   CDS             join(952476..952494,952653..952756,952920..952959,
FT                   953062..953127,953203..953502,953567..953607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000163690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877882"
FT                   /gene_name="sar1"
FT                   /gene_synonym="sarA"
FT                   /orf_name="An01g04040"
FT                   /product="Small COPII coat GTPase SAR1 "
FT                   /EC_number="3.6.5.-"
FT                   /function="GTP binding"
FT                   /function="hydrolase activity"
FT                   /biological_process="intracellular protein transport "
FT                   /biological_process="vesicle-mediated transport "
FT                   /cellular_component="ER to Golgi transport vesicle membrane"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK36940.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0012507"
FT                   /db_xref="GO:0016192"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG745225"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="UniParc:UPI0000EF9E35"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0C951"
FT                   /transl_table=1
FT                   /translation="MWLINWFYDLLASLGLLNKHAKLLFLGLDNAGKTTLLHMLKNDRV
FT                   AILQPTAHPTSEELAIGNNRFTTFDLGGHQQARRLWKDYFPEVSGIVFLVDAKDHERFP
FT                   ESKAELDALLAMEELAKVPFLILGNKIDHPDAVSEDELRHQLGLYQTTGKGKVPLEGIR
FT                   PIEVFMCSVVMRQGYGEGIRWLSQYV"
     MWLINWFYDL LASLGLLNKH AKLLFLGLDN AGKTTLLHML KNDRVAILQP TAHPTSEELA        60
     IGNNRFTTFD LGGHQQARRL WKDYFPEVSG IVFLVDAKDH ERFPESKAEL DALLAMEELA       120
     KVPFLILGNK IDHPDAVSED ELRHQLGLYQ TTGKGKVPLE GIRPIEVFMC SVVMRQGYGE       180
     GIRWLSQYV                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page