(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE388

ASPNC_1.PE388        Location/Qualifiers
FT   CDS             join(964270..964278,964378..965058)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877885"
FT                   /orf_name="An01g04090"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36945.1"
FT                   /db_xref="UniParc:UPI0000EF9E3A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8E8"
FT                   /transl_table=1
FT                   /translation="MALKVVTHQRRNQPAIYSNSDIMLPTYLAIYQLITTTNTIIHPPT
FT                   VHHPKPHNQKQSKCHPQNKNSLSSSTPSSRNLSNTTTGCVKPSPKPTNLLRTLSLTIPP
FT                   ILIPQTLSSLHSLTSFLLGLTAGILSLQSATGFLFYLLGTVFVSALFHALLLYRSGGLG
FT                   AGMYFAGANGEVEGMDERGVVSGKGTKGGGMLRRAAWRDVWFGGGVLSEALSGFILGWA
FT                   GVGGVLR"
     MALKVVTHQR RNQPAIYSNS DIMLPTYLAI YQLITTTNTI IHPPTVHHPK PHNQKQSKCH        60
     PQNKNSLSSS TPSSRNLSNT TTGCVKPSPK PTNLLRTLSL TIPPILIPQT LSSLHSLTSF       120
     LLGLTAGILS LQSATGFLFY LLGTVFVSAL FHALLLYRSG GLGAGMYFAG ANGEVEGMDE       180
     RGVVSGKGTK GGGMLRRAAW RDVWFGGGVL SEALSGFILG WAGVGGVLR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page