(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE395

ASPNC_1.PE395        Location/Qualifiers
FT   CDS             join(complement(978726..978795),complement(978667..978670),
FT                   complement(978348..978360),complement(977976..978100),
FT                   complement(977687..977776),complement(977483..977629),
FT                   complement(977295..977439))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19806942"
FT                   /orf_name="An01g04160"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36952.1"
FT                   /db_xref="UniParc:UPI0000EF9E41"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F5"
FT                   /transl_table=1
FT                   /translation="MGGGQLIIKMRLRPPLEPLKNVKVKYELLGAISCTFGDPPPITGR
FT                   LDIVRPVTAGTVASAQEAGPPSSTARYLAQSDQHGVCVLRPPDWPRNPSALQTKSICIL
FT                   LVLRYCISQVQGSAIGIPASRDSERLLHSSPEPKNGTPWLTVAVILNFWISIGTERGNA
FT                   IRTTPTMRNAKILRDRLSIHHGLVQLSNPEYPAR"
     MGGGQLIIKM RLRPPLEPLK NVKVKYELLG AISCTFGDPP PITGRLDIVR PVTAGTVASA        60
     QEAGPPSSTA RYLAQSDQHG VCVLRPPDWP RNPSALQTKS ICILLVLRYC ISQVQGSAIG       120
     IPASRDSERL LHSSPEPKNG TPWLTVAVIL NFWISIGTER GNAIRTTPTM RNAKILRDRL       180
     SIHHGLVQLS NPEYPAR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page