(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE396

ASPNC_1.PE396        Location/Qualifiers
FT   CDS             join(979942..980039,980067..980113,980277..980446,
FT                   980519..980637,980774..980878,981078..981161,
FT                   981269..981334,981613..981894,982008..982085,9
FT                   82393..982492)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15877889"
FT                   /orf_name="An01g04170"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36953.1"
FT                   /db_xref="UniParc:UPI0000EF9E42"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8F6"
FT                   /transl_table=1
FT                   /translation="MVSHILGLNPVGDNVGYRAKHPSRLRCRNARLGQIVCPGAVDGWN
FT                   GDPVATKTQESPGREWKTECGYGVTPVGSDDSKGGSPLQSTARMISSRSRLSSPIKADI
FT                   AGENAKAVGGRETDREMNSDQGCLSVPSLRTLRTYVPHYILIDPDASHHFGKPKHSTRL
FT                   MIDRRQTAEAWFMNRGRCGSKPDAVCWTEGTRTIERKKQVTYGGGSATCKKNLPVLAKP
FT                   YESTTLAGKSDKGCSANSTPIEPMLIAMPRAACHTDIFIQTGGNIEIQAANVRRTVLLE
FT                   GRGDGTLSGWWAGRNLSWSYGRAAERLSFATLLTTYATLIGDLVCVRDTHSNAPQISAA
FT                   GRAHGRHLITRILGLTGSSITVLLIAVTDVCAKKAEPYIPGQ"
     MVSHILGLNP VGDNVGYRAK HPSRLRCRNA RLGQIVCPGA VDGWNGDPVA TKTQESPGRE        60
     WKTECGYGVT PVGSDDSKGG SPLQSTARMI SSRSRLSSPI KADIAGENAK AVGGRETDRE       120
     MNSDQGCLSV PSLRTLRTYV PHYILIDPDA SHHFGKPKHS TRLMIDRRQT AEAWFMNRGR       180
     CGSKPDAVCW TEGTRTIERK KQVTYGGGSA TCKKNLPVLA KPYESTTLAG KSDKGCSANS       240
     TPIEPMLIAM PRAACHTDIF IQTGGNIEIQ AANVRRTVLL EGRGDGTLSG WWAGRNLSWS       300
     YGRAAERLSF ATLLTTYATL IGDLVCVRDT HSNAPQISAA GRAHGRHLIT RILGLTGSSI       360
     TVLLIAVTDV CAKKAEPYIP GQ                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page