(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE4

ASPNC_1.PE4          Location/Qualifiers
FT   CDS             5250..>6158
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15874677"
FT                   /orf_name="An01g00040"
FT                   /product="Function: in S. cerevisiae TFIIF is required for
FT                   initiation at most"
FT                   /function="DNA binding"
FT                   /function="RNA polymerase II transcription factor activity "
FT                   /function="catalytic activity"
FT                   /function="transcription activator activity"
FT                   /biological_process="transcription initiation from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAK36849.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003702"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006367"
FT                   /db_xref="GO:0016563"
FT                   /db_xref="InterPro:IPR008851"
FT                   /db_xref="InterPro:IPR011039"
FT                   /db_xref="UniParc:UPI0000EF9E9A"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q7B4"
FT                   /transl_table=1
FT                   /translation="MTTPTNDQTLKTPTGSNGPPPVRIRRPKVADPLVRPKRRPAIRPP
FT                   APTSAANGASRMPNSRPVTSSQLPGARVEKSLNPKNDFSANGFSGPLLSENYVDYPIVT
FT                   TRRALREGLKHHIARFTSKKSVDPRDESQFTRPVRLQRRDPRARPNEAHVERGQLNSKP
FT                   GSEQSTQMDELEREELEARKAAREKERAENMAQIAPSVGSAPKRHNAPKQKTQQVTKTD
FT                   MTPEEIARTRIKYEEALPWHLEDFDNKNIWVGNYEAALSETHAVFVLENTGKMRMIPVE
FT                   KWYRFSAKNTFKALTIEEAERL"
     MTTPTNDQTL KTPTGSNGPP PVRIRRPKVA DPLVRPKRRP AIRPPAPTSA ANGASRMPNS        60
     RPVTSSQLPG ARVEKSLNPK NDFSANGFSG PLLSENYVDY PIVTTRRALR EGLKHHIARF       120
     TSKKSVDPRD ESQFTRPVRL QRRDPRARPN EAHVERGQLN SKPGSEQSTQ MDELEREELE       180
     ARKAAREKER AENMAQIAPS VGSAPKRHNA PKQKTQQVTK TDMTPEEIAR TRIKYEEALP       240
     WHLEDFDNKN IWVGNYEAAL SETHAVFVLE NTGKMRMIPV EKWYRFSAKN TFKALTIEEA       300
     ERL                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page