(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE405

ASPNC_1.PE405        Location/Qualifiers
FT   CDS             join(complement(999195..999353),complement(998860..999125),
FT                   complement(998761..998782))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960201"
FT                   /orf_name="An01g04260"
FT                   /product="Catalytic activity: cytosine + H(2)O [ "
FT                   /EC_number="3.5.4.1"
FT                   /function="cytosine deaminase activity"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAK36962.1"
FT                   /db_xref="GO:0004131"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG741046"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniParc:UPI0000EF9E5B"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8G5"
FT                   /transl_table=1
FT                   /translation="METDPGFIAAVEEAKQGAAEGGVPIGACLVSKDGKILGRGHNMRV
FT                   QKGSPVLHAEMSALENSGRLPASAYEGATMYTTLSPCDMCTGACILYKVKRVVVGENKS
FT                   FMGGEDYLKSRGKEVVVLDNAECKQLMEKFMKEKPELWNEDISV"
     METDPGFIAA VEEAKQGAAE GGVPIGACLV SKDGKILGRG HNMRVQKGSP VLHAEMSALE        60
     NSGRLPASAY EGATMYTTLS PCDMCTGACI LYKVKRVVVG ENKSFMGGED YLKSRGKEVV       120
     VLDNAECKQL MEKFMKEKPE LWNEDISV                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page