(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE412

ASPNC_1.PE412        Location/Qualifiers
FT   CDS             join(1017660..1017732,1017816..1017973,1018056..1018172)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654282"
FT                   /orf_name="An01g04340"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36969.1"
FT                   /db_xref="UniParc:UPI0000EF9E62"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H2"
FT                   /transl_table=1
FT                   /translation="MAEKAEGNESESEGKERQGERYRATQADERWRTINLLTQSKTWVL
FT                   NVVSVTSVTGLIVGSAACFLLSSFETEGEWIWSRREREDIPFERAGQMVKTKPQNNSIR
FT                   HAGWTCGSILG"
     MAEKAEGNES ESEGKERQGE RYRATQADER WRTINLLTQS KTWVLNVVSV TSVTGLIVGS        60
     AACFLLSSFE TEGEWIWSRR EREDIPFERA GQMVKTKPQN NSIRHAGWTC GSILG            115
//

If you have problems or comments...

PBIL Back to PBIL home page