(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE417

ASPNC_1.PE417        Location/Qualifiers
FT   CDS             join(1028410..1028549,1028641..1028715,1028928..1028974,
FT                   1029311..1029592,1029720..1029792,1029923..1030274)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111069"
FT                   /orf_name="An01g04390"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK36974.1"
FT                   /db_xref="UniParc:UPI0000EF9E71"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8H7"
FT                   /transl_table=1
FT                   /translation="MLTLFRLAQSRPFVRNLLLWKQNDVFTSEPDRALHRGGLGCRINI
FT                   DGWMLWGSDATASMASTPHMAPFPHSRCLAQCVAHEYLLRVIATFSCAVTGYIRSTYQA
FT                   DQQVLTDPWFAHLFFCQPIFIGDDAVLFRDPDPERRPITPRYFNPAFSGLRVSASRGLE
FT                   SSIFLVAADTSRWASPVRRIRTSVAFAKNEQVNGPGTGWTKKKASLCFPQFLMLVFSLL
FT                   QLPDNTSRHVPGEKKELCGSVPRQVTPSLTRNPLVAGPVGSLPTMGHQPEPGSLDCLHS
FT                   HSQGISQHEWPPESGPPYSVLVESAFLAPKLSLSRGLEALP"
     MLTLFRLAQS RPFVRNLLLW KQNDVFTSEP DRALHRGGLG CRINIDGWML WGSDATASMA        60
     STPHMAPFPH SRCLAQCVAH EYLLRVIATF SCAVTGYIRS TYQADQQVLT DPWFAHLFFC       120
     QPIFIGDDAV LFRDPDPERR PITPRYFNPA FSGLRVSASR GLESSIFLVA ADTSRWASPV       180
     RRIRTSVAFA KNEQVNGPGT GWTKKKASLC FPQFLMLVFS LLQLPDNTSR HVPGEKKELC       240
     GSVPRQVTPS LTRNPLVAGP VGSLPTMGHQ PEPGSLDCLH SHSQGISQHE WPPESGPPYS       300
     VLVESAFLAP KLSLSRGLEA LP                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page