(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE438

ASPNC_1.PE438        Location/Qualifiers
FT   CDS             join(complement(1091082..1091234),
FT                   complement(1091013..1091020),complement(1089714..1090947))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210812" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20654549"
FT                   /gene_name="prpA"
FT                   /orf_name="An01g04600"
FT                   /product="PDI related protein A prpA-Aspergillus niger "
FT                   /EC_number="5.3.4.1"
FT                   /function="protein disulfide isomerase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAK36995.1"
FT                   /db_xref="GO:0003756"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG329960"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="UniParc:UPI000006BCA8"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8J8"
FT                   /transl_table=1
FT                   /translation="MLQPSSALLFVTSLLAALPVNADGLYTKKSPVLQVNQKNYDQLIA
FT                   NSNHTSIVEFYAPWCGHCQNLKPAYEKAATNLDGLAKVAAVNCDYDDNKPFCGRMGVQG
FT                   FPTLKIVTPGKKPGKPRVEDYKGARSAKAIVEAVVDRIPNHVKRATDKDLDTWLAQDEE
FT                   SPKAILFTEKGTTSPLLRALAIDFLGSIQVAQVRNKETEAVEKFGITEFPTFVLLPGGG
FT                   QDPIVYDGELKKKPMVEFLSQAAAPNPDPAPKGSTAPRDNNKKKSTEPSPDSKIVSDEA
FT                   KPASVPIPAPPIGTLPTAEALEAACLMPKSGTCVLALLPEPSEPDAELPAPAKDALLSL
FT                   AEISHKHAVRKSKLFPFYSVPAINSGAKTLRAGLGLPEDNSVEIVAVNGRRGWWRRYDS
FT                   VEGAEYGQERVEAWIDAIRLGEGEKQKLPDGVVVEEVVEEKVEEKVEEVVEEPVEEKPA
FT                   VDHDEL"
     MLQPSSALLF VTSLLAALPV NADGLYTKKS PVLQVNQKNY DQLIANSNHT SIVEFYAPWC        60
     GHCQNLKPAY EKAATNLDGL AKVAAVNCDY DDNKPFCGRM GVQGFPTLKI VTPGKKPGKP       120
     RVEDYKGARS AKAIVEAVVD RIPNHVKRAT DKDLDTWLAQ DEESPKAILF TEKGTTSPLL       180
     RALAIDFLGS IQVAQVRNKE TEAVEKFGIT EFPTFVLLPG GGQDPIVYDG ELKKKPMVEF       240
     LSQAAAPNPD PAPKGSTAPR DNNKKKSTEP SPDSKIVSDE AKPASVPIPA PPIGTLPTAE       300
     ALEAACLMPK SGTCVLALLP EPSEPDAELP APAKDALLSL AEISHKHAVR KSKLFPFYSV       360
     PAINSGAKTL RAGLGLPEDN SVEIVAVNGR RGWWRRYDSV EGAEYGQERV EAWIDAIRLG       420
     EGEKQKLPDG VVVEEVVEEK VEEKVEEVVE EPVEEKPAVD HDEL                        464
//

If you have problems or comments...

PBIL Back to PBIL home page