(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE440

ASPNC_1.PE440        Location/Qualifiers
FT   CDS             join(complement(1095281..1095445),
FT                   complement(1093500..1095152))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878875"
FT                   /orf_name="An01g04620"
FT                   /product="Function: the DnaJ-domain is part of a chaperone "
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAK36997.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="UniParc:UPI0000EF9EAF"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K0"
FT                   /transl_table=1
FT                   /translation="MYSAARVTNYYSILGISHNSTLKDINSAYKKLALKHHPDKQGTGS
FT                   ADVSNDEFQKIQEAIETLRDPIRKQEHDDSLRRAGYYFHSTPFASDDEYEDWEKGTWRP
FT                   TSGKRYCDLTDPMELYKYKYGHSVHMDPFAPESLVEKARVEIEIRVGEQLKREAEAAEA
FT                   AAAAGGMRSGNGDDEGEEDEGVEDDGGVLFEKPQHFQDILEYLRNQEAASVEKRKMAMK
FT                   ANVDKDEERLRNGEDEEEFEHDEKEFARGYGNEYCWRSQEAGPDVPREWHENFYYNEEE
FT                   AAYYGGDEDEGEGEGDEEEDDEDDEEDDEEEDDNRRGENQNDDFEDEDEDDEQPQGPGA
FT                   GAPTQHHGNSYDVDRYDDDGYYHSDEEDDCYDDGGHNNGADIYFFKFSHTASEQPASSC
FT                   SDSTEYVTAKCARESDDESVLDEAGGVCVTHYMSNKPQPTDSSIFSPSSINLPSSPSVM
FT                   PLLTSPSIKLNATANINNGDPLLFHFYSKLDDPGNSYTSQDFVFELTGMVFDMYCGWLE
FT                   CVRLTFPEAKPLTKEQQDTSACLHLGGWEKRFGRDKCKGCHLRQPLYMLNCPGCGIEKC
FT                   VGCRLTAAAAVGKGVGDLLEGWDVTALGW"
     MYSAARVTNY YSILGISHNS TLKDINSAYK KLALKHHPDK QGTGSADVSN DEFQKIQEAI        60
     ETLRDPIRKQ EHDDSLRRAG YYFHSTPFAS DDEYEDWEKG TWRPTSGKRY CDLTDPMELY       120
     KYKYGHSVHM DPFAPESLVE KARVEIEIRV GEQLKREAEA AEAAAAAGGM RSGNGDDEGE       180
     EDEGVEDDGG VLFEKPQHFQ DILEYLRNQE AASVEKRKMA MKANVDKDEE RLRNGEDEEE       240
     FEHDEKEFAR GYGNEYCWRS QEAGPDVPRE WHENFYYNEE EAAYYGGDED EGEGEGDEEE       300
     DDEDDEEDDE EEDDNRRGEN QNDDFEDEDE DDEQPQGPGA GAPTQHHGNS YDVDRYDDDG       360
     YYHSDEEDDC YDDGGHNNGA DIYFFKFSHT ASEQPASSCS DSTEYVTAKC ARESDDESVL       420
     DEAGGVCVTH YMSNKPQPTD SSIFSPSSIN LPSSPSVMPL LTSPSIKLNA TANINNGDPL       480
     LFHFYSKLDD PGNSYTSQDF VFELTGMVFD MYCGWLECVR LTFPEAKPLT KEQQDTSACL       540
     HLGGWEKRFG RDKCKGCHLR QPLYMLNCPG CGIEKCVGCR LTAAAAVGKG VGDLLEGWDV       600
     TALGW                                                                   605
//

If you have problems or comments...

PBIL Back to PBIL home page