(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE441

ASPNC_1.PE441        Location/Qualifiers
FT   CDS             join(complement(1097153..1097208),
FT                   complement(1096379..1096953),complement(1096207..1096319),
FT                   complement(1096127..1096147),complement(1096040..1096074),
FT                   complement(1095895..1095988))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000215911" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878876"
FT                   /orf_name="An01g04630"
FT                   /product="Complex: more in detail "
FT                   /EC_number="3.6.3.14"
FT                   /function="hydrogen ion transporting ATP synthase activity,
FT                   rotational mechanism"
FT                   /function="proton-transporting ATPase activity, rotational
FT                   mechanism"
FT                   /biological_process="ATP synthesis coupled proton transport"
FT                   /cellular_component="proton-transporting ATP synthase
FT                   complex, catalytic core F(1)"
FT                   /protein_id="CAK36998.1"
FT                   /db_xref="GO:0015986"
FT                   /db_xref="GO:0045261"
FT                   /db_xref="GO:0046933"
FT                   /db_xref="GO:0046961"
FT                   /db_xref="HOGENOM:HBG586593"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="UniParc:UPI0000EF9EB0"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K1"
FT                   /transl_table=1
FT                   /translation="MFSRAVRPAVRAGSIAVSRTAPPNAANFATLREIEGRLKSIKNIE
FT                   KITNTMKVIASTRLTRAQKAMEDSRAYGQTSNTVFENAETKPLEDKKTLLVVASSDKGL
FT                   CGGIHSGLSKATRRMLQQYPDADIVVLGEKAKAQLSRTNPNAIVLSFANVCKDIPTFND
FT                   AQSIADQISQLPTDYASVKIIYNQFINAQSYEAGTVEAYSEEAITQSPNLSTFETDDQT
FT                   LAHLREYALANNLFWAMAEGHACEISARRNAMENASKNAGEMINKFQILYNRQRQAAIT
FT                   GELVEIITGATASADM"
     MFSRAVRPAV RAGSIAVSRT APPNAANFAT LREIEGRLKS IKNIEKITNT MKVIASTRLT        60
     RAQKAMEDSR AYGQTSNTVF ENAETKPLED KKTLLVVASS DKGLCGGIHS GLSKATRRML       120
     QQYPDADIVV LGEKAKAQLS RTNPNAIVLS FANVCKDIPT FNDAQSIADQ ISQLPTDYAS       180
     VKIIYNQFIN AQSYEAGTVE AYSEEAITQS PNLSTFETDD QTLAHLREYA LANNLFWAMA       240
     EGHACEISAR RNAMENASKN AGEMINKFQI LYNRQRQAAI TGELVEIITG ATASADM          297
//

If you have problems or comments...

PBIL Back to PBIL home page