(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE443

ASPNC_1.PE443        Location/Qualifiers
FT   CDS             join(complement(1104152..1104203),
FT                   complement(1103916..1104077),complement(1102904..1103814))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111329"
FT                   /orf_name="An01g04650"
FT                   /product="Similarities to UDPglucose 4-epimerase galE from
FT                   Neisseria gonorrhoeae"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAK37000.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="HOGENOM:HBG323870"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI0000EF9EB2"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8K3"
FT                   /transl_table=1
FT                   /translation="MADEQSKKPAVLIVGGLGFIGRHLALYLHENNLASEVRLVDKVLP
FT                   QLAWLAPEFQEACSKDKFVQADASREQHFPRIFDRANGEQFDYVINCGGETRHSQPDDV
FT                   YEVRSYALTVALGREVARRGIRSFVECSTAHVYKGGSSPRKEDDKLQPWHKLAKWKMKA
FT                   SEELQKIPGLNYCLLRLPHVYGEYDSGYFAMGICLARVHLELEKDLELLYTKDLKINTV
FT                   YVRDAASALWKAAEWRASAPTDGSAPLAFNVVDHGNTRQEDIAQALSEVFKLKCDFLGS
FT                   LASQFAKLNLDDVVDDMNEECLQGWADLLEEKKIERPGPIGPFLEKDVLKDQDMCLDGT
FT                   LFETTTGWKPSRERFNADAVRDMVDSYKRMGWWP"
     MADEQSKKPA VLIVGGLGFI GRHLALYLHE NNLASEVRLV DKVLPQLAWL APEFQEACSK        60
     DKFVQADASR EQHFPRIFDR ANGEQFDYVI NCGGETRHSQ PDDVYEVRSY ALTVALGREV       120
     ARRGIRSFVE CSTAHVYKGG SSPRKEDDKL QPWHKLAKWK MKASEELQKI PGLNYCLLRL       180
     PHVYGEYDSG YFAMGICLAR VHLELEKDLE LLYTKDLKIN TVYVRDAASA LWKAAEWRAS       240
     APTDGSAPLA FNVVDHGNTR QEDIAQALSE VFKLKCDFLG SLASQFAKLN LDDVVDDMNE       300
     ECLQGWADLL EEKKIERPGP IGPFLEKDVL KDQDMCLDGT LFETTTGWKP SRERFNADAV       360
     RDMVDSYKRM GWWP                                                         374
//

If you have problems or comments...

PBIL Back to PBIL home page