(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE450

ASPNC_1.PE450        Location/Qualifiers
FT   CDS             join(1120003..1120192,1120245..1120795,1120847..1121608)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000212154" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18111331"
FT                   /orf_name="An01g04720"
FT                   /product="Complex: eukaryotic DNA primase is a heterodimer
FT                   of a large subunit"
FT                   /EC_number="2.7.7.-"
FT                   /function="DNA primase activity"
FT                   /biological_process="DNA replication, synthesis of RNA
FT                   primer"
FT                   /protein_id="CAK37007.1"
FT                   /db_xref="GO:0003896"
FT                   /db_xref="GO:0006269"
FT                   /db_xref="HOGENOM:HBG617734"
FT                   /db_xref="InterPro:IPR007238"
FT                   /db_xref="InterPro:IPR016558"
FT                   /db_xref="UniParc:UPI0000EF9EB9"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L0"
FT                   /transl_table=1
FT                   /translation="MIRQDFRRIDPKRRATLDHKKKQFATPVFKQQDYPHRLNFYEVPP
FT                   TDEITLEQFEQWAIDRLKVLAEIEACSYRNKSPAETEAHITPHLQKYLPLSSNTSSSNG
FT                   AADQRLKNERQKDHYSHFILRLAFSATEELRRRFVRAETMLFRFRFQRDDTRERRAFIE
FT                   SLNLDWEPVDDEEKQRLAEQLLAASPGLRRIDDETWYKVDWEKVPELVERRAVFLSKGK
FT                   AYVPGREQLSMIIAEFTARLERALELTSRALPRLDEDDRLTPILNHLSKNFGSAESVYT
FT                   ENEGFVDGAPITANNIDRLSQHFPLCMRSLHMNLRKNNHLKHYGRLQYTLFLKGIGLSL
FT                   EECIVFWRQGFKGLTDDEFNSRYKYNIRHAYGDVGGDQNRRGRGYPPYSCQKILGDSNP
FT                   GVGQTHGCPYRHFSVDNLIGLLQSTGVNDRDVLRGVREDVEKMRFHIACNRVFEHTHKA
FT                   DIKRVKEDGTWNQTDLDTIVHPNTYFKRSYLLKQMGKAPKNA"
     MIRQDFRRID PKRRATLDHK KKQFATPVFK QQDYPHRLNF YEVPPTDEIT LEQFEQWAID        60
     RLKVLAEIEA CSYRNKSPAE TEAHITPHLQ KYLPLSSNTS SSNGAADQRL KNERQKDHYS       120
     HFILRLAFSA TEELRRRFVR AETMLFRFRF QRDDTRERRA FIESLNLDWE PVDDEEKQRL       180
     AEQLLAASPG LRRIDDETWY KVDWEKVPEL VERRAVFLSK GKAYVPGREQ LSMIIAEFTA       240
     RLERALELTS RALPRLDEDD RLTPILNHLS KNFGSAESVY TENEGFVDGA PITANNIDRL       300
     SQHFPLCMRS LHMNLRKNNH LKHYGRLQYT LFLKGIGLSL EECIVFWRQG FKGLTDDEFN       360
     SRYKYNIRHA YGDVGGDQNR RGRGYPPYSC QKILGDSNPG VGQTHGCPYR HFSVDNLIGL       420
     LQSTGVNDRD VLRGVREDVE KMRFHIACNR VFEHTHKADI KRVKEDGTWN QTDLDTIVHP       480
     NTYFKRSYLL KQMGKAPKNA                                                   500
//

If you have problems or comments...

PBIL Back to PBIL home page