(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE451

ASPNC_1.PE451        Location/Qualifiers
FT   CDS             join(1122380..1122472,1122529..1122659,1122724..1123018,
FT                   1123084..1123554,1123611..1124708,1124763..1124956,
FT                   1125014..1125038)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000231690" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18960443"
FT                   /gene_name="sec23"
FT                   /orf_name="An01g04730"
FT                   /product="Protein transport protein sec23 "
FT                   /function="zinc ion binding"
FT                   /biological_process="ER to Golgi vesicle-mediated transport"
FT                   /biological_process="intracellular protein transport "
FT                   /cellular_component="COPII vesicle coat"
FT                   /cellular_component="Golgi membrane"
FT                   /cellular_component="endoplasmic reticulum membrane "
FT                   /protein_id="CAK37008.1"
FT                   /db_xref="GO:0000139"
FT                   /db_xref="GO:0005789"
FT                   /db_xref="GO:0006886"
FT                   /db_xref="GO:0006888"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0030127"
FT                   /db_xref="HOGENOM:HBG520631"
FT                   /db_xref="InterPro:IPR006895"
FT                   /db_xref="InterPro:IPR006896"
FT                   /db_xref="InterPro:IPR006900"
FT                   /db_xref="InterPro:IPR007123"
FT                   /db_xref="InterPro:IPR012990"
FT                   /db_xref="UniParc:UPI0000EF9EBA"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2Q8L1"
FT                   /transl_table=1
FT                   /translation="MDYEALKDQWSDVEDRDGIRLSWNTFPSSRMEASRLVVPIGAVYT
FT                   PLKEKPDSPLLQYEPVTCKAPCRAVLNPYANVDVRARIWICPFCLMRNPLPPHYKDITE
FT                   STIPPELHPMSTTIEYQLARPAPAPPIFVYVVDTCQDDDSLKALKDSLIMSLSLLPVNA
FT                   LVGLITYGTMAQVHELGYTECAKSYVFRGSKEYAAKQVQEMLGLASGLRPNMPQQPARP
FT                   PLGPAARFLLPVQQAEFQITNVLEQLQRDPWPVANDKRPLRCTGVALSVAVGLLETSFQ
FT                   NAGGRIMVFTSGPATEGPGHVVGPELKEPIRSHHDIDRDNIKYYKKAVKFYDNMAKRAA
FT                   NNGHIVDVFAGCLDQVGMLEMKNLANYTGGHILLTDSFTSSQFKQSFVRIFDKDAKDNL
FT                   LMGFNASLEVLTTKELKVTGLIGHAVSLNKKSSSVGETECGIGNTCAWKMCGIDPASSY
FT                   GVYFEIANQGGPAAVQPGPQRGMMQFLTYYQHSSGHYHLRVTTVARPLSGPAGDPTLAQ
FT                   SFDQEAAAVLMARIAVFKAEVDDGPDVLRWVDRMLIRLCSRFADYRKDDPTSFRLEKNF
FT                   TLYPQFMFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVGDSLVMIQPTLDSYSLEHEGS
FT                   QPVLLDSASIQPAHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYENLKVLLEQPKED
FT                   ARELISDRFPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGGYGGGVTSQIIFTDDVSLQ
FT                   TFMDHLMKLAVSGTS"
     MDYEALKDQW SDVEDRDGIR LSWNTFPSSR MEASRLVVPI GAVYTPLKEK PDSPLLQYEP        60
     VTCKAPCRAV LNPYANVDVR ARIWICPFCL MRNPLPPHYK DITESTIPPE LHPMSTTIEY       120
     QLARPAPAPP IFVYVVDTCQ DDDSLKALKD SLIMSLSLLP VNALVGLITY GTMAQVHELG       180
     YTECAKSYVF RGSKEYAAKQ VQEMLGLASG LRPNMPQQPA RPPLGPAARF LLPVQQAEFQ       240
     ITNVLEQLQR DPWPVANDKR PLRCTGVALS VAVGLLETSF QNAGGRIMVF TSGPATEGPG       300
     HVVGPELKEP IRSHHDIDRD NIKYYKKAVK FYDNMAKRAA NNGHIVDVFA GCLDQVGMLE       360
     MKNLANYTGG HILLTDSFTS SQFKQSFVRI FDKDAKDNLL MGFNASLEVL TTKELKVTGL       420
     IGHAVSLNKK SSSVGETECG IGNTCAWKMC GIDPASSYGV YFEIANQGGP AAVQPGPQRG       480
     MMQFLTYYQH SSGHYHLRVT TVARPLSGPA GDPTLAQSFD QEAAAVLMAR IAVFKAEVDD       540
     GPDVLRWVDR MLIRLCSRFA DYRKDDPTSF RLEKNFTLYP QFMFHLRRSQ FLQVFNNSPD       600
     ETAFYRHVLN HEDVGDSLVM IQPTLDSYSL EHEGSQPVLL DSASIQPAHI LLLDTFFHIL       660
     IFHGETIAEW RKAGYQDQEG YENLKVLLEQ PKEDARELIS DRFPLPRFIV CDAGGSQARF       720
     LLSKLNPSTT HTTGGYGGGV TSQIIFTDDV SLQTFMDHLM KLAVSGTS                    768
//

If you have problems or comments...

PBIL Back to PBIL home page