(data stored in ACNUC7421 zone)

HOGENOMDNA: ASPNC_1.PE457

ASPNC_1.PE457        Location/Qualifiers
FT   CDS             join(1141966..1142081,1142244..1142435,1142514..1142721)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15878882"
FT                   /orf_name="An01g04800"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="CAK37014.1"
FT                   /db_xref="UniParc:UPI0000EF9EDD"
FT                   /db_xref="UniProtKB/TrEMBL:A2Q8L7"
FT                   /transl_table=1
FT                   /translation="MSCSRSFNKSCENMGSCYNAFNNQGSLGPEACTWGFSLWLVCWTT
FT                   CLPLYLTNFLRCQSWIVVDVPSTEPRYCVCGACRTEGEWAVSTHVQDQLPWEMDNRVDA
FT                   DWLFDGYVDEDGAFLVCSPHKTPSLAYAEYKKWIMIFLQTRFCRARVERPRELVRLVVA
FT                   ELAARKYW"
     MSCSRSFNKS CENMGSCYNA FNNQGSLGPE ACTWGFSLWL VCWTTCLPLY LTNFLRCQSW        60
     IVVDVPSTEP RYCVCGACRT EGEWAVSTHV QDQLPWEMDN RVDADWLFDG YVDEDGAFLV       120
     CSPHKTPSLA YAEYKKWIMI FLQTRFCRAR VERPRELVRL VVAELAARKY W                171
//

If you have problems or comments...

PBIL Back to PBIL home page